Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4132.t1
Gene name
Locationscaffold_08:77635..93171
Strand+
Gene length (bp)15536
Transcript length (bp)15240
Coding sequence length (bp)15240
Protein length (aa) 5080

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 7.3E-39 793 1200
PF00668 Condensation Condensation domain 8.7E-44 1853 2271
PF00668 Condensation Condensation domain 2.2E-28 2412 2819
PF00668 Condensation Condensation domain 4.9E-26 3495 3911
PF00668 Condensation Condensation domain 3.8E-37 4060 4426
PF00668 Condensation Condensation domain 3.4E-13 4614 4933
PF00501 AMP-binding AMP-binding enzyme 1.5E-67 195 576
PF00501 AMP-binding AMP-binding enzyme 4.5E-15 1233 1358
PF00501 AMP-binding AMP-binding enzyme 5.2E-16 1394 1611
PF00501 AMP-binding AMP-binding enzyme 2.0E-82 2852 3248
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-04 692 748
PF00550 PP-binding Phosphopantetheine attachment site 2.3E-07 1749 1814
PF00550 PP-binding Phosphopantetheine attachment site 3.2E-07 2309 2371
PF00550 PP-binding Phosphopantetheine attachment site 4.3E-05 3385 3449
PF00550 PP-binding Phosphopantetheine attachment site 6.9E-12 3958 4020
PF00550 PP-binding Phosphopantetheine attachment site 5.8E-09 4509 4571

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 5.20 3.14 7.25
5d_25C Five days - 25 degrees Celsius 5.11 3.06 7.16
7d_25C Seven days - 25 degrees Celsius 3.51 2.04 4.97
10d_25C Ten days - 25 degrees Celsius 4.29 2.50 6.07
7d_15C Seven days - 15 degrees Celsius 2.36 1.30 3.43
7d_30C Seven days - 30 degrees Celsius 7.34 4.50 10.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.959417 no
3d_25C 7d_25C 0.077844 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.110419 no
3d_25C 10d_25C 0.451666 no
5d_25C 7d_25C 0.097721 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.097175 no
5d_25C 10d_25C 0.510549 no
7d_25C 7d_15C 0.101296 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.451938 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.006742 yes
7d_30C 10d_25C 0.008469 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4132.t1
MDRFTQFPAVNDDGDDVHIVPWQVDAQLPSEILALSWAVLLRAFTTDENPVFLLNGAPVKADLSAQTVQPAHLAA
VSDLSVKHTAIVLGDPPSDDDGHLPVLQWTLDPTTQLGTLRAAGGMDATFLYQLGNQLKVIVQEQAVLKGIPVTV
SATEVPDLAISNASPSTLPGPRLLHELALRELNNSNHAIEFLKADGNVQCLSYHDLDRLSSELASKIARASTTSP
GLQKVVPVLLPQSVELYISWLAILKAGAAFCPLNTDAPTDRIEFILQDVAASVVVTNDALVTRIPLKEHISILTV
DDLQTNADITEPCAENSTSTDLAYVMYTSGSTGRPKGVGVSHLAATQSLLAHDDLIPPFKRFLQFASPTFDVSVF
EVFFPMMRGSTLIGSERENMLLDISHVMTTMRVDAAELTPTVAGELLRTRAAAPSLRVLLTIGEMLTRHVVDEFG
QSEGRGGILHGMYGPTEAAIHCTAATHFQAKDPVNMIGKPFKTVSAYIMPLPSDEPSSKELRPLSLGQIGELVVG
GPQLADGYINRPEENAKAFIDSPVYGRLYRTGDKARILPTGEIECFGRISNGQVKLRGQRIELGEIEHVITRASG
VRSAVTMVIDGNLVAFVLVTDKGTTDISLRDVCRRLLPRFMIPGEFLLVDQFPQLPSGKIDRKTLEANFIRHRST
ALAFDDQPCRDEKEESIASSVADVLGRRLPSTESLAAAGLDSLAAIRLASHLLDAGIRLGVASLLEADSVDGIWQ
LATSLEAMSPNNDTQAALQTILQLVLDAGAARVDSLGLSDQVSDVIPCSHIQQAMILETVRDNKAYCNWIELEFE
PSVSSTAVKNAFGQLVDHNQILRSGFVEIGLKDHSYGRFTWNTVNDHISLKHELEYDLGLSAGHDVLNPFRVQIK
EGKDHLRVLVHIHHALYDGWSWQIMLKDLRSILSGEELTSKPPYNIVANYFIEHKLDKSAIESSVYWREQLQGLY
PATFPIFHGHTDIIHATDKATRVLDISVSKLNQVSQHLRVSRQTIFQAAFCYILSSYIGTGDITFGTVFSGRTLP
LKGIETVLGPCIRTLPTRMNLDKMQDVTDLLLAIQNMNRKSLEHGSLSLQDIKKASGIDLDRSLFDTALVWQESI
WSDDDQGSVFREVGAGEFLEFALLLEFEPREENIFARATYQESVLPVEQAMILLEQIDSVASVLIDKIKLPIQEI
RSYLPSSTLSIEHATLRDQVNLPSLASSVEMIASTDPDRVAVELMLWKSENSTSLMESMTYSQLNSRANGFAHFL
LHIGVTNDDLIAIHLTTSLDFYVAVLGVAKAGAGLLLLPQASSQKIHSILSTAKSKFCIIDHLTERDHSLDSLKS
VQLIHLFYSLDVYHEFNIPYTSKGSDVAYAEVSLIEDDLIENIVISRQNLQSNINALSDSYPAPTGSKMLSCLQG
SGASICQAFFAWHAGMTLCSATELIMMTRIEQACQDMNITHLHLPPMLASRIDPQAVPSVQYLLSSGEEMTLKLH
HNWAGKGLNQAYSNHALTHACTLCLNMQASTHVRNIGRPLKNTSAMIVADGDSLSLLPRGAIGELCFGGDQIGRC
LPDSKSPVTGRFVDHPEFGLIYRTGDSGRLLPDGTLILSRSSGLAQSYAPSIDLDGVDRALMSLEMAKETVSMIL
DEPTLRLAVFWVPSKKCSGSVQIEKATNDLFKELTKKLSSSDLPSLLVLVDTIDLTRSYKIDYFKLRQRLGQLIT
KELAIFSPKPNTDTSDSFTDLEKTISAALSAVTGTDQTNVRKHTSFYRLGLDSLSAISFSRKLQESGCGRLAVST
ILRHSSISQLAAVITATTNGDQPENAVPAPPTVFDEIFTHQIEDEFKATAINVQSIYPCTPLQEAMLAAESGDHS
AYFNHLLLLVHTNAETMRAAWAKMMQRQGILRTCFTQTNDRRFAYAQVVLDTSVLPWSHIETSSSELENVIKENK
SKFEGISPVNGQLPYSLTLITDSTAQQTYLLLSIHHALYDGEGIAQLLQELQLLISSQKLPKNTPFRNFIDYMTS
VDYGSSDEYWDQYLSGVSPTLLPTPGPAANANESASQQIHTSLNGSFVSFRQNCKDLSVTPLNIFHAAWARLLSL
YTGSSDVCFGNVFSCRTVPLDGADRIVGPCFNTLPIRIKSSSTSTNSDIMKLSQKSNNDILPHQLSPLRRIQRRI
LGDGSRLFETLVIFQNRNTDLDSNIWELLQDEGNMGFPLICEIIRDESKDKIQICLHFQVSYISQAVAEKIARDF
IVLVGHIIQYPSAQASDKRLLGADIPRVFEHNVSKTSKSVQFPTKSRQKLPWSYREEIVRDLLCKFSDVDSDNVF
QDTTIFQLGLDSINAVQVSAKLRELGYKISSGDILEAASIDQIASLLTSNAKIVEEIEFDFGLFQTNYLQSVCQQ
LEISSQIVQSLRPCTPVQNGMLAIFTHSHGEVYFNRMTLRSSVPLDKKVLKEAWSKVMAQHEMLRTGFVELRDQN
NPFAMITYHEYGKLPWYETSSSMEVTSGVQQRHALENLHQPPWSIEVEVGDHTSIMHFSALHAIYDAQSLATILS
DVRAAYEGKALAMPAPVTKTLGPILLESKSQSESAQSFWKGLAPEVQPSKFPDLNPIRTNERTLLTTSIRCIQSR
KAFEDACRDIGVTLQAAGQATWARLLSAYTGESNVTFGTVLSGRNLSADAQHAVFPCLVTVPTPLHIEGSNRQLL
DCTLKRNALLVKNQFAPLSHIQRWLGSDEPLFDTLFVYQKFNSDAVGADKWDIIGEETNIDYPVSIELIPHWNDL
QISLSYRGDLVPMEQAKILLNQYERLLQDTVFCPDVNSTDYDSVGSSLLSITPAKEAPIPTTVSLLHQFVETNAI
NIPEKIAFEFAFGDIAENLQKKTWTYREFNECGNQIAHFLQAKGAIPGGIVGICFDKCPEASMAILGIMKAGCAY
LAIDPGAPISRKQFMLEDSATKILLCNQSKMAELDGLPAIDVQALDEPGLLDRVSTGDISLSRPIQPDDTCYCLY
TSGTTGTPKGCEITHDNAVQAMLAFQRLFAGHWDEESRWLQFASFHFDVSVLEQYWSWSVGICVTSCPRDLLFED
LTGTIQKLRITHIDLTPSLARLVHPDEVPSLCRGVFITGGEALKQEILDVWGKHGVIYNGYGPTEVTIGCTMLPR
MSANDKASNIGPQFDNVGSYVFSPGTTTPVLRGSIGELCVSGPLVGKGYLNRVELTKERFQELPESGDRIYRTGD
LVRILHDGSFQFLGRIDDQVKLRGQRLEIGEINEVIKQATPELNEVATLVITHPKQSKDQLVSFFTTVTADKKSR
AVDVGVRYSEEDRALLSKIKGACRTHLPRYMVPTHIIPMTQFPLSANNKADMKVLKSIYQELSLENIQKLSSMSV
SQSTDSVQEQKIISVLARFIGSSEEKISSWSSIYELGLDSISVIAFSRSLREAGFSQAQPSTIMKYPTISGMTSA
LQVPISSSVSVETFQRNAKQGIEAFAHKNSHAIIEHIGARYGDIEKIAPCTPLQEGIIYHYLASSTPLYCSSFTF
ELDPSVNLENLRAAWDQAQRDVQMLRARFLPSPDGYAQIVMKKDALPWFLATAGTNQEIDDLRKERHDHWIAQLD
GLSSNLWEVGVISSPKISVMCLNIFHALYDGNSLVLLLELVARSYLGQIESSELIPEFLDVLHLGPLCKNPAAEA
FWKVHLAGCRDRAFAEDGQVDSAPILLKAQMNATDQVDHLRRSLNVTEQAVLHACWLLTLQQQYSFVPPLGIIAS
GRTIDVPGIGDVIGPLFNTIPSNVQLHGLESWSDVARRCHDYQVSMIPFQYTALRDIVKWLGKNPDERLFSSLFV
FQREDDNDESFTKDLWCTLDSEAQHEYPLAFEIVRNSKQFFTATIAAKSHAVSSEDAQQMLSKFEQILFEFAQDP
KRELPKINGVSLAQVVADGEVKGHHESPRTPEHTNGEHTNFEHINGSLFEWTSQACIIRDVIETLAGVEPQSINE
NTSIFEVGLDSIDAIKISSRLSKAGIKLPVSSIMRHRTVKAMSEQLSMTNGHTKDGTLSSLNRLEKLLTEFLGAE
GLLPPSAIRVLPATPIQEAMVAEMCASGYKHYYNHEILELEPDVDIEKMERAWRAVVRAHPILRTSFVEVWDPKI
PVSYAQIVHNEDQIDLKTIHLHGVSVESVIKTQRSRVHNKPAGCPLLSITIAVEGDRRYLVLSISHALYDGWSIN
LLHEDVAKSYAGVECSRPPADEILGQIIASSGDEALRFWRATLSKFTPVSFSPMEHAENSSVVVHRAEQSLSVPM
SKAEMFCKRHGITLQALLVGCWSLVLARHVKKLDVVFGLVLSGRNVANSEHVMFPTMNTVAMRVILHGTRVELVK
YVQEALLAMSEHQHFPLRRARPDTGSRALFDTLFMYQKRPVEIVQNEPRQVLYKSTGGAAEVEYPVCAEVEGVGE
DLVGRVACRGNVTGYQDTLVLLEQMSDILSSIIDGPSEQTVDFTSEGVKICGSAAFQDESEQNIEPEAVPGTLDQ
AEWSPIESKIRKILSIASGVPDDSIDKSSTIFELGLDSISAIKVAALLKKQSVKLAVSDMLRAGTVENMAKAANS
GLTEVSLTNISSILHDSLDGIDVAGLLQSHGIDLQLVRKVFPTTAGQTYFLSMHILNPEIFYPEFYYLTSRQLSP
EVLDRAWARVIDQTPMLRTVFVPTSDSPLLPYMQIEFEVVHIPVIWHSKFDRHLVSRSPKQEFGVVPVALHACQT
NQGTALILQIHHALYDAVSLPHILNRLVTHCGQEDVVKPNPDLDLAQLVAFQYVHSPVDVRRQFWQKYLGQISTA
VKRGHCFGSVQHHYRPGLVSNMASVEKVAKRRGLSIQTVFLAVYARVHLQQFGAAETTNGAGSRRRLTVGLYLAN
RSHSIEGLAESVIPTVNIVPLRLDDKLSDSNDTLLDAARRIQTEINEISRPEYSGVSLLEIAEWTGIRIDTCVNF
LRLPEQELKVPGNCDHAKFSFTAIQREEFEDLSGAAPVSKNDPIPINGNGVAPPGAAETIPGLEHPSASTAATQD
IFQSTIDVEAAIRNGRLDFGLFAPESRLDRDTAETVIGAMQREMSALVTGFESI*
Coding >Pro_DTO377G3_2|g4132.t1
ATGGACCGATTCACTCAATTCCCTGCCGTCAATGACGATGGTGATGATGTTCATATTGTACCCTGGCAGGTGGAT
GCCCAACTCCCCTCGGAGATACTTGCTTTGTCATGGGCAGTCTTGCTACGTGCATTCACAACGGATGAGAATCCC
GTCTTTCTATTGAATGGTGCGCCAGTCAAGGCAGATCTGTCTGCCCAAACGGTTCAGCCAGCACATCTGGCTGCC
GTATCAGATCTCTCAGTCAAACACACTGCCATAGTGCTGGGAGATCCTCCGTCCGATGATGATGGACATCTCCCG
GTGTTGCAGTGGACCCTGGACCCCACGACTCAGCTGGGAACTTTGCGTGCGGCTGGAGGCATGGATGCTACTTTC
CTGTACCAGTTGGGCAACCAGCTGAAGGTGATCGTGCAAGAGCAGGCTGTTCTAAAGGGTATACCGGTGACAGTG
TCTGCCACCGAGGTTCCTGATCTAGCCATTTCAAATGCCTCCCCCTCCACATTACCAGGGCCCCGGCTTCTACAC
GAGCTTGCCCTGCGTGAGCTCAACAATTCAAACCATGCCATTGAATTCCTCAAGGCGGATGGAAACGTTCAGTGC
CTGTCGTACCATGACTTGGACCGGCTTTCCTCGGAGCTGGCGAGTAAAATAGCTCGTGCTTCGACGACCTCTCCG
GGCCTACAGAAGGTTGTGCCAGTACTTTTGCCCCAGTCTGTGGAATTGTACATTTCATGGCTGGCTATCCTCAAG
GCTGGCGCAGCTTTCTGCCCCTTGAACACCGATGCACCAACAGATCGCATCGAGTTTATCCTGCAAGATGTGGCC
GCATCGGTGGTGGTCACAAATGATGCTCTTGTAACAAGGATACCGCTGAAAGAGCATATTTCTATTCTCACAGTG
GACGATCTTCAAACCAACGCCGATATCACAGAGCCATGCGCAGAAAACAGCACTTCCACTGATCTGGCGTATGTC
ATGTACACATCTGGCTCTACGGGCCGCCCTAAAGGCGTCGGGGTGTCCCATCTTGCTGCCACCCAATCACTCCTT
GCTCATGATGATTTGATACCCCCTTTCAAGCGCTTTTTACAATTTGCATCTCCCACCTTTGATGTTTCTGTGTTT
GAGGTCTTTTTCCCGATGATGCGAGGGTCAACCCTCATCGGGTCTGAGAGAGAGAATATGCTTCTTGATATTTCC
CATGTGATGACGACGATGAGAGTCGATGCCGCTGAGTTGACCCCAACGGTGGCAGGAGAGTTGCTGCGCACGCGA
GCCGCCGCTCCGTCTCTCCGAGTGCTCCTCACAATTGGCGAGATGCTTACCAGACACGTGGTAGACGAGTTTGGC
CAGTCCGAGGGCAGGGGTGGCATTCTCCATGGAATGTACGGGCCCACCGAAGCAGCAATCCATTGTACCGCGGCC
ACCCATTTCCAGGCCAAGGATCCTGTCAATATGATTGGAAAGCCCTTCAAAACCGTGTCGGCATACATCATGCCA
CTCCCTTCCGACGAGCCATCCTCCAAGGAGCTTCGTCCCCTTTCACTAGGCCAAATTGGAGAGCTTGTGGTGGGT
GGTCCTCAATTGGCAGACGGGTATATCAACCGACCCGAAGAAAATGCCAAGGCTTTTATAGACAGTCCGGTGTAT
GGCCGACTCTATCGCACGGGAGACAAAGCCCGCATACTCCCCACTGGAGAGATTGAGTGTTTTGGCCGAATTTCC
AACGGCCAGGTGAAGCTGCGAGGTCAGCGGATAGAGCTAGGCGAGATTGAGCATGTTATCACCAGAGCCTCTGGT
GTCCGCAGTGCTGTTACCATGGTTATCGACGGGAACTTAGTTGCATTTGTTTTGGTTACCGACAAGGGAACGACG
GACATTAGTCTCCGAGATGTCTGTCGTCGGCTGTTGCCTCGCTTTATGATCCCCGGAGAATTCCTGCTCGTCGAC
CAATTCCCCCAACTTCCCTCGGGCAAGATCGATCGTAAAACACTAGAAGCCAATTTCATTCGCCACCGAAGCACT
GCCCTGGCTTTTGATGATCAACCCTGCCGAGACGAAAAAGAGGAGTCTATCGCCTCAAGCGTAGCCGATGTGCTA
GGCCGACGACTCCCGTCGACAGAGAGCCTGGCAGCAGCAGGTCTTGATTCGCTAGCAGCAATCCGTCTCGCGTCT
CATCTCTTGGATGCAGGAATTCGGCTAGGTGTGGCTTCCTTGTTGGAGGCCGACTCAGTGGACGGAATCTGGCAA
CTTGCCACCAGTCTTGAAGCTATGAGCCCAAATAATGATACGCAAGCAGCCTTGCAAACCATTCTTCAGCTTGTT
TTAGACGCAGGTGCAGCAAGGGTCGACTCGCTGGGCTTGAGCGATCAGGTTTCGGACGTCATACCGTGTAGCCAT
ATCCAACAGGCTATGATCTTGGAGACTGTTCGAGATAACAAGGCATACTGCAACTGGATTGAGCTGGAATTCGAG
CCCTCGGTCAGTTCAACTGCGGTAAAGAATGCATTTGGTCAACTGGTGGACCACAACCAGATCTTACGGTCCGGA
TTTGTGGAAATCGGCCTCAAAGATCACTCATATGGTCGATTCACCTGGAATACTGTCAATGACCATATTTCCCTG
AAACATGAACTTGAATACGATTTGGGCCTGAGTGCGGGTCACGATGTCTTGAACCCTTTTCGAGTCCAGATCAAA
GAAGGCAAGGACCATCTCCGCGTGCTGGTGCATATCCATCATGCTCTTTATGATGGATGGTCTTGGCAAATTATG
TTGAAAGATCTCAGAAGTATCTTGTCCGGAGAGGAGCTCACTTCCAAACCGCCATATAACATCGTCGCAAACTAT
TTCATTGAGCACAAACTGGACAAATCGGCAATAGAGTCCTCAGTGTACTGGCGTGAACAACTCCAAGGTCTTTAT
CCTGCAACTTTCCCTATTTTCCACGGACATACAGATATAATACATGCTACCGACAAGGCTACTCGCGTGCTGGAC
ATATCCGTATCAAAACTCAACCAAGTTTCCCAGCATCTTCGCGTGAGCCGGCAAACCATTTTTCAAGCCGCGTTT
TGCTATATTCTCTCTTCCTACATTGGAACCGGTGATATCACATTTGGAACTGTCTTTTCAGGCCGAACTCTGCCC
TTGAAGGGCATTGAAACGGTTCTCGGGCCTTGTATCAGAACTTTGCCTACGCGCATGAACCTCGACAAAATGCAG
GACGTGACCGATCTTCTTTTGGCCATCCAGAATATGAACCGCAAGTCACTCGAGCATGGCAGTCTTTCTCTTCAG
GATATCAAGAAGGCTTCTGGTATCGACTTGGATCGCAGTCTCTTCGACACAGCGCTCGTGTGGCAGGAAAGCATT
TGGTCAGATGATGACCAGGGCTCGGTGTTCCGGGAAGTTGGAGCGGGGGAGTTTTTAGAATTTGCGCTGTTGCTG
GAGTTTGAGCCGCGAGAAGAAAACATCTTTGCTCGGGCGACATATCAAGAGTCGGTGCTACCAGTTGAGCAAGCT
ATGATACTACTCGAGCAGATTGATTCTGTGGCCTCGGTCTTGATTGACAAGATTAAGCTTCCAATCCAGGAGATT
CGATCGTATCTTCCCTCGTCAACGCTGTCAATTGAACATGCAACATTACGCGATCAAGTCAATTTGCCAAGCCTG
GCATCTAGCGTCGAGATGATTGCTTCTACAGACCCGGACCGGGTAGCGGTTGAGTTGATGCTCTGGAAGTCAGAG
AATTCTACTTCGTTGATGGAAAGCATGACCTATAGTCAACTAAACTCCCGAGCCAATGGCTTTGCACACTTCTTG
CTCCATATCGGAGTGACAAATGACGATCTAATAGCCATTCATCTGACAACGTCTCTTGACTTTTATGTTGCTGTG
CTTGGAGTCGCCAAGGCCGGTGCTGGTCTCCTCCTCCTTCCCCAGGCTTCTTCGCAGAAAATCCATTCTATTCTC
TCCACGGCGAAATCCAAGTTCTGTATCATCGACCACTTGACGGAAAGAGATCATAGCTTGGATTCTCTGAAGTCC
GTCCAGCTGATTCATCTCTTTTATTCACTGGATGTTTACCATGAGTTTAATATTCCATATACCAGTAAAGGGTCT
GACGTTGCCTATGCTGAAGTGTCGCTAATTGAAGATGACTTGATTGAAAACATCGTCATCTCACGGCAAAACCTG
CAGAGCAATATCAATGCTCTGTCAGACTCGTATCCAGCGCCAACCGGATCGAAAATGCTATCATGTCTTCAGGGA
TCAGGTGCATCTATTTGCCAGGCATTCTTTGCTTGGCATGCTGGCATGACATTGTGCTCAGCTACAGAATTGATA
ATGATGACTCGTATCGAGCAAGCCTGTCAAGACATGAACATAACACACCTGCACTTGCCTCCCATGCTGGCCTCC
CGTATTGATCCACAAGCCGTCCCCAGTGTGCAATATCTCCTCTCTTCTGGTGAAGAAATGACCCTTAAGCTCCAT
CACAATTGGGCCGGCAAAGGTCTGAATCAAGCATACAGCAACCATGCACTGACTCACGCATGTACTCTCTGTCTT
AATATGCAGGCATCGACCCATGTTCGAAACATTGGTAGACCCCTGAAGAACACATCTGCCATGATTGTAGCAGAT
GGAGATTCGCTCAGCCTTCTTCCACGCGGTGCCATTGGAGAGCTATGCTTCGGCGGGGATCAAATTGGGCGCTGT
CTACCTGACTCCAAGTCGCCAGTTACTGGGCGATTCGTTGATCATCCTGAGTTTGGTCTGATCTATAGAACGGGT
GACTCTGGAAGGCTGCTTCCTGATGGTACACTCATTCTTTCCCGAAGCTCTGGCCTTGCTCAGTCGTATGCTCCG
TCTATTGATCTAGACGGAGTTGATCGTGCTCTGATGTCTTTAGAAATGGCAAAAGAAACAGTGAGCATGATTTTG
GATGAGCCGACACTGCGATTGGCAGTGTTCTGGGTTCCTTCAAAGAAATGCTCAGGTTCCGTGCAAATCGAGAAG
GCTACGAATGATCTTTTCAAGGAGCTCACCAAGAAACTTTCTTCTTCTGACCTTCCATCCCTTCTTGTTCTCGTT
GACACGATAGATCTCACTAGGTCTTATAAGATTGATTACTTCAAGCTGAGGCAACGGTTGGGGCAACTGATAACG
AAGGAGCTTGCGATATTTTCACCAAAGCCTAATACCGATACTAGTGACAGTTTCACTGATCTTGAGAAGACTATC
TCTGCCGCGCTATCGGCAGTCACTGGCACCGACCAAACAAACGTCCGCAAACACACATCTTTCTACAGACTGGGT
CTGGACTCTCTTTCTGCCATTTCCTTCTCGCGAAAGCTGCAGGAGTCTGGATGTGGAAGGCTTGCCGTGTCCACA
ATCCTGCGCCATAGCTCTATTTCTCAACTTGCAGCTGTCATTACTGCCACGACCAACGGGGATCAGCCCGAAAAT
GCGGTGCCCGCACCACCAACAGTGTTCGATGAAATCTTCACTCATCAAATAGAAGATGAGTTCAAAGCTACAGCC
ATAAATGTTCAAAGCATTTACCCTTGCACTCCACTCCAGGAGGCTATGCTTGCAGCTGAATCTGGTGATCATTCG
GCTTATTTCAATCACCTCTTGCTTCTTGTGCATACCAATGCCGAGACCATGAGAGCAGCATGGGCTAAGATGATG
CAAAGACAAGGCATTCTTAGAACTTGTTTCACGCAAACTAATGATAGGCGGTTCGCATATGCTCAGGTTGTACTG
GACACATCGGTCTTACCGTGGTCCCATATTGAAACTTCCTCTTCTGAGCTTGAGAATGTCATCAAGGAAAACAAG
TCCAAGTTCGAGGGTATTTCTCCTGTCAACGGCCAGTTGCCTTACTCATTGACTTTGATAACCGATTCAACTGCG
CAGCAGACATATCTTCTACTGTCCATCCATCATGCACTGTATGACGGAGAAGGTATCGCCCAGTTATTGCAAGAG
CTCCAGCTGTTGATTTCAAGTCAAAAGTTGCCAAAGAACACTCCATTCCGCAACTTCATCGATTACATGACCTCT
GTTGATTATGGCTCGTCGGATGAATACTGGGACCAGTACCTGTCCGGTGTTTCACCGACCCTCCTTCCCACACCC
GGGCCCGCAGCCAATGCAAATGAGTCGGCATCACAGCAGATCCATACATCCCTCAATGGCTCTTTCGTATCATTC
AGGCAAAACTGCAAAGACCTCTCCGTGACCCCTTTGAACATCTTCCATGCTGCATGGGCCAGACTCCTCTCTCTA
TACACCGGTTCATCCGACGTCTGCTTTGGCAATGTCTTCAGCTGCCGAACCGTTCCCTTGGATGGCGCAGATCGG
ATAGTCGGGCCTTGTTTCAACACACTCCCAATTCGAATCAAGTCTTCTTCAACTTCAACAAATAGTGACATCATG
AAATTGTCCCAAAAGAGCAATAACGACATTTTGCCTCACCAACTCAGCCCTCTCCGGCGTATTCAACGACGTATT
CTTGGCGATGGCTCTCGCCTTTTCGAGACGCTCGTCATTTTCCAGAACAGAAATACAGATCTCGATTCCAATATC
TGGGAACTTCTTCAGGACGAAGGAAACATGGGATTCCCCTTGATATGTGAGATCATCCGCGACGAGTCTAAAGAC
AAAATACAGATCTGCCTCCACTTCCAAGTATCGTATATCTCACAAGCCGTGGCTGAGAAAATTGCGCGGGACTTT
ATAGTCCTTGTTGGACACATCATTCAATATCCGTCTGCTCAGGCATCCGATAAGCGGCTATTAGGGGCAGACATT
CCTCGAGTATTTGAACATAACGTGTCTAAGACGTCAAAATCTGTTCAGTTCCCCACAAAATCTCGCCAAAAGCTC
CCATGGTCCTATCGAGAGGAGATTGTTCGCGACCTTCTTTGCAAATTTTCGGATGTCGACTCGGATAATGTGTTC
CAGGACACAACGATCTTCCAACTTGGCCTGGATAGTATCAACGCTGTTCAGGTATCGGCGAAGTTGCGTGAGTTA
GGGTATAAGATCTCATCTGGTGATATTCTCGAGGCTGCTTCTATTGATCAAATCGCTTCCCTTCTTACTTCCAAC
GCGAAGATTGTTGAGGAAATCGAGTTCGACTTTGGACTTTTCCAAACCAATTATTTGCAGTCTGTTTGCCAGCAA
CTTGAGATTTCTTCGCAAATAGTGCAGTCTCTGCGCCCTTGTACGCCAGTCCAAAACGGAATGCTGGCAATTTTT
ACACATTCACACGGTGAAGTGTACTTCAATAGAATGACCTTAAGGTCCTCAGTACCTTTAGATAAGAAGGTCTTG
AAAGAAGCATGGTCTAAGGTCATGGCTCAGCATGAGATGCTTCGAACAGGATTTGTTGAATTGCGCGATCAGAAT
AATCCTTTTGCTATGATAACTTACCATGAATACGGCAAATTACCATGGTACGAGACCTCGTCTTCCATGGAAGTC
ACTTCTGGTGTTCAACAAAGGCACGCTTTGGAAAATCTCCACCAGCCTCCATGGAGCATTGAAGTCGAAGTAGGT
GACCACACCAGTATCATGCATTTCTCTGCATTGCATGCTATTTATGATGCTCAGTCTCTGGCCACCATACTTTCA
GACGTCAGAGCAGCATATGAAGGAAAGGCTCTGGCTATGCCGGCCCCAGTCACCAAAACTCTCGGCCCTATCCTT
CTTGAGAGTAAGAGCCAGAGCGAATCAGCGCAATCCTTCTGGAAGGGACTTGCCCCAGAAGTGCAGCCCTCCAAA
TTCCCCGACTTAAATCCCATCCGCACAAACGAGCGAACATTACTCACCACCTCCATCCGTTGCATACAGTCTCGC
AAGGCTTTTGAAGATGCCTGTCGAGATATCGGCGTGACACTACAAGCAGCGGGGCAAGCCACGTGGGCTCGCTTG
CTCTCTGCGTACACGGGCGAGTCCAACGTCACTTTTGGAACCGTGCTTTCAGGTAGAAACTTGTCCGCTGATGCT
CAGCATGCGGTATTCCCGTGTTTGGTCACAGTGCCGACGCCCCTGCATATTGAGGGTTCCAACCGACAGCTTTTG
GACTGTACGTTGAAGCGAAATGCTTTATTGGTAAAGAATCAGTTCGCGCCTCTGTCGCATATCCAGCGTTGGCTA
GGTAGCGATGAGCCACTCTTCGACACGCTGTTTGTCTATCAGAAGTTTAATTCTGATGCCGTTGGTGCTGATAAG
TGGGACATCATTGGCGAGGAGACGAATATTGATTATCCTGTCTCTATCGAATTGATTCCGCACTGGAACGATCTT
CAGATTTCGTTGAGCTACCGGGGCGATCTTGTACCCATGGAGCAAGCAAAGATCCTCTTGAATCAGTATGAAAGA
TTATTGCAAGATACTGTCTTCTGTCCAGATGTCAATTCCACCGATTACGACTCTGTGGGTAGTAGTCTGCTATCA
ATTACTCCTGCCAAAGAAGCACCAATTCCTACCACGGTTTCTTTGCTACATCAATTCGTCGAGACGAACGCGATC
AATATTCCCGAGAAGATTGCGTTTGAATTTGCTTTCGGTGACATTGCAGAAAATCTGCAGAAGAAGACATGGACT
TACCGTGAGTTCAATGAATGTGGCAATCAAATTGCGCATTTCCTGCAGGCCAAGGGGGCTATTCCTGGTGGAATT
GTGGGAATATGCTTCGACAAGTGCCCTGAAGCCTCCATGGCGATTCTGGGTATTATGAAAGCTGGATGTGCATAT
CTGGCTATTGACCCTGGTGCTCCTATCTCTCGTAAGCAGTTCATGTTAGAGGACTCGGCTACCAAGATCCTCCTT
TGCAATCAATCGAAGATGGCGGAACTAGATGGTCTTCCAGCTATTGATGTCCAGGCACTTGATGAGCCTGGGCTT
CTTGACCGGGTTTCAACAGGGGATATCTCACTTTCCCGTCCTATCCAGCCAGATGATACTTGTTATTGTCTGTAC
ACATCCGGTACAACTGGAACACCGAAGGGCTGCGAGATCACGCACGATAATGCCGTGCAAGCAATGCTGGCATTC
CAACGATTGTTCGCAGGACACTGGGATGAAGAGTCTCGGTGGTTGCAATTTGCCTCCTTCCATTTTGACGTCAGT
GTTTTGGAACAGTACTGGAGCTGGAGTGTTGGAATTTGCGTCACTTCCTGTCCACGCGATTTGCTGTTTGAGGAC
CTGACTGGAACGATACAAAAGCTTCGAATTACGCATATTGACCTGACGCCCAGTTTGGCAAGACTAGTCCATCCC
GATGAAGTTCCGTCGCTTTGTCGGGGAGTCTTCATCACCGGCGGAGAGGCCCTGAAACAAGAAATCCTAGATGTC
TGGGGCAAGCATGGTGTCATCTACAATGGATACGGTCCTACTGAAGTTACTATCGGATGCACCATGCTCCCACGG
ATGTCTGCCAATGACAAAGCCTCAAACATCGGGCCTCAATTCGATAATGTGGGGTCATATGTCTTCAGCCCCGGT
ACGACGACACCAGTCCTACGCGGCAGCATAGGCGAACTCTGCGTCTCGGGACCTCTCGTTGGAAAGGGCTATCTG
AATCGAGTGGAGCTCACCAAGGAAAGATTCCAAGAGCTTCCCGAATCTGGCGATCGCATCTATCGCACTGGCGAT
CTTGTGAGAATTTTGCACGATGGAAGCTTCCAGTTCCTCGGTCGCATTGATGACCAGGTCAAGCTCCGCGGACAG
CGACTTGAGATTGGAGAAATCAACGAGGTCATCAAACAAGCTACGCCTGAATTGAACGAAGTCGCTACCCTGGTC
ATCACGCACCCCAAACAATCGAAGGATCAACTTGTCTCCTTTTTCACGACTGTCACTGCAGATAAGAAATCTCGT
GCTGTCGACGTTGGAGTCCGATATTCAGAAGAGGACCGCGCCCTGCTATCGAAGATCAAGGGTGCTTGCCGCACT
CATCTTCCTAGGTACATGGTGCCTACACATATCATCCCGATGACCCAATTTCCGCTGTCTGCCAATAACAAGGCT
GATATGAAAGTCTTGAAGAGTATCTATCAGGAGCTTTCGCTAGAAAACATTCAGAAATTGAGCTCGATGAGCGTT
AGCCAGTCTACTGACAGTGTCCAGGAACAGAAGATCATATCTGTCCTGGCGAGGTTTATTGGTTCCTCTGAGGAG
AAGATCTCATCATGGTCCAGTATCTACGAGCTTGGTCTGGATTCTATATCTGTTATTGCTTTCTCGAGAAGTCTC
CGGGAGGCTGGGTTTTCTCAGGCTCAGCCATCGACCATCATGAAGTACCCTACAATTTCCGGCATGACGTCGGCT
CTACAGGTGCCTATCTCATCTTCTGTGTCCGTGGAAACCTTCCAACGCAATGCCAAGCAAGGCATCGAGGCTTTC
GCTCACAAAAACTCCCACGCTATCATCGAGCATATTGGAGCCCGCTACGGTGACATTGAAAAGATTGCGCCCTGC
ACCCCGCTTCAGGAGGGTATCATATACCACTACCTGGCTAGTAGCACGCCGTTGTACTGCTCATCTTTCACTTTC
GAGCTCGACCCTTCAGTGAACCTCGAGAATTTGCGCGCGGCTTGGGATCAGGCCCAGAGAGACGTTCAGATGTTG
CGCGCCAGATTTCTGCCATCTCCAGACGGCTATGCCCAAATTGTCATGAAGAAAGACGCCCTTCCTTGGTTCCTT
GCTACGGCCGGTACCAATCAAGAGATTGATGACTTGCGCAAAGAACGACATGACCACTGGATTGCCCAGCTCGAC
GGTCTTTCATCCAATCTATGGGAAGTCGGAGTCATCTCTTCCCCCAAGATATCGGTAATGTGTTTGAACATCTTC
CATGCTCTCTATGATGGAAACAGCCTAGTCCTGCTCCTCGAATTGGTTGCCCGAAGTTATCTCGGTCAGATCGAG
AGTTCGGAGTTAATCCCGGAATTCCTTGATGTGTTGCACTTGGGTCCCCTTTGTAAAAACCCTGCTGCAGAGGCG
TTCTGGAAAGTTCATCTTGCTGGCTGTCGTGATCGAGCTTTCGCCGAGGACGGCCAAGTAGACAGCGCGCCAATT
CTGCTTAAAGCTCAAATGAATGCGACAGATCAAGTTGACCATCTTCGCCGGTCTCTCAATGTTACAGAGCAAGCT
GTCCTTCATGCCTGTTGGCTTCTTACTCTCCAGCAACAATACTCCTTCGTGCCACCACTTGGTATCATTGCCTCA
GGCAGGACAATCGATGTACCAGGCATTGGCGACGTTATTGGACCGCTGTTCAATACGATCCCCAGCAATGTCCAG
CTGCATGGCTTGGAGTCTTGGTCTGATGTCGCTCGGCGCTGCCATGACTACCAGGTGTCCATGATTCCTTTCCAA
TACACCGCCTTGCGGGACATCGTGAAATGGCTCGGAAAGAACCCCGACGAGCGGCTCTTCAGCTCCTTGTTTGTC
TTCCAGAGGGAAGATGATAACGACGAATCGTTCACAAAAGATCTTTGGTGTACACTTGACTCGGAGGCCCAGCAT
GAATACCCTCTGGCCTTTGAGATTGTACGCAATAGCAAGCAATTTTTTACAGCCACTATTGCCGCAAAGAGTCAT
GCGGTATCGTCGGAAGATGCTCAGCAGATGTTATCTAAGTTTGAGCAAATTCTTTTTGAGTTTGCGCAAGACCCC
AAAAGAGAGTTGCCCAAGATAAATGGGGTGTCTCTCGCACAAGTTGTGGCGGATGGTGAAGTGAAGGGACACCAC
GAGTCTCCAAGAACCCCAGAACATACCAATGGTGAACATACCAATTTCGAACATATTAATGGCTCTTTGTTTGAA
TGGACTTCCCAGGCTTGCATAATTCGCGACGTGATTGAAACCCTTGCGGGGGTGGAGCCGCAATCCATCAACGAG
AACACATCAATCTTTGAAGTTGGACTTGATAGCATCGATGCCATCAAAATCTCCTCGCGGTTGAGCAAAGCCGGC
ATCAAACTTCCTGTGAGTTCCATCATGCGCCATCGTACAGTCAAGGCAATGAGCGAGCAACTCTCAATGACAAAT
GGTCATACCAAGGATGGGACATTATCATCACTTAATCGGCTAGAGAAATTGTTGACCGAGTTCCTCGGGGCTGAA
GGTCTTCTCCCCCCGAGCGCGATTCGAGTCTTACCAGCCACACCCATCCAAGAAGCTATGGTCGCTGAAATGTGT
GCCTCTGGGTACAAGCATTATTACAACCACGAGATCCTCGAGCTTGAGCCAGATGTAGACATTGAAAAGATGGAG
CGGGCATGGAGAGCTGTCGTTAGAGCTCACCCTATCCTCCGTACTTCATTTGTTGAAGTCTGGGATCCGAAGATT
CCTGTTTCATACGCCCAAATAGTTCACAACGAGGATCAAATTGACCTCAAGACTATCCATCTACACGGCGTCTCC
GTGGAATCCGTTATAAAGACTCAGCGCTCAAGGGTCCACAATAAGCCGGCAGGCTGTCCCTTGCTCTCTATCACC
ATTGCAGTGGAAGGGGATAGGCGGTACCTTGTTTTGTCAATTTCGCATGCTCTCTATGATGGTTGGTCAATCAAT
CTGCTCCACGAAGACGTTGCCAAATCGTATGCTGGTGTAGAGTGTTCTCGCCCGCCAGCCGATGAAATTCTCGGG
CAAATCATTGCCTCGTCTGGCGACGAAGCCCTCAGATTCTGGCGAGCAACGCTATCCAAATTCACCCCGGTGTCA
TTCTCTCCTATGGAACATGCGGAGAATAGCTCGGTTGTCGTTCACCGAGCAGAACAATCATTATCCGTTCCAATG
TCCAAGGCGGAGATGTTCTGCAAACGTCATGGCATTACCCTCCAGGCGCTTCTTGTCGGCTGCTGGTCTCTTGTC
CTTGCTAGGCATGTCAAGAAGCTAGATGTGGTATTTGGGCTTGTCCTTTCCGGTCGGAATGTGGCTAACTCTGAG
CACGTGATGTTCCCGACTATGAACACTGTCGCCATGCGAGTTATTCTTCATGGGACGCGGGTAGAATTGGTGAAA
TATGTGCAGGAGGCTCTCCTCGCCATGTCGGAGCATCAGCATTTCCCGCTTCGGCGCGCCAGACCAGATACGGGA
TCGCGGGCATTGTTCGATACGCTTTTCATGTATCAGAAGAGACCGGTCGAAATTGTCCAGAATGAGCCTAGGCAA
GTCTTATATAAATCTACTGGCGGAGCAGCCGAAGTTGAATACCCTGTTTGCGCTGAAGTTGAAGGTGTCGGGGAG
GATCTAGTTGGACGAGTTGCTTGTCGTGGAAATGTTACTGGGTATCAAGATACTCTTGTGCTGTTGGAGCAGATG
AGCGATATCCTTTCGTCTATCATCGATGGTCCATCTGAACAGACTGTGGATTTTACCAGTGAGGGAGTGAAGATT
TGTGGAAGCGCCGCTTTCCAGGATGAGTCTGAACAAAATATCGAGCCTGAAGCAGTGCCCGGGACACTCGATCAG
GCGGAATGGTCGCCGATTGAGTCAAAGATCCGCAAAATTCTTTCTATTGCATCCGGGGTACCTGATGATTCCATT
GACAAGAGCTCCACCATCTTCGAGCTTGGCCTGGACAGTATCAGCGCCATCAAGGTGGCTGCACTCCTGAAGAAA
CAGTCCGTCAAGCTTGCGGTCAGTGACATGCTTCGGGCTGGTACTGTTGAAAACATGGCCAAAGCAGCCAACAGC
GGCCTAACGGAGGTCTCGCTCACAAATATATCAAGCATTCTCCACGATTCACTCGATGGCATCGATGTGGCGGGA
CTGCTACAGTCACATGGTATTGATTTGCAACTAGTACGAAAGGTGTTCCCCACAACTGCAGGGCAAACCTATTTC
CTCTCAATGCACATTCTGAATCCAGAGATATTCTATCCTGAGTTTTACTATCTGACATCACGACAATTGAGCCCT
GAAGTACTCGATCGGGCCTGGGCTCGGGTCATAGACCAAACCCCAATGCTTCGGACGGTATTCGTTCCCACTTCC
GACTCTCCGCTATTACCCTATATGCAGATCGAGTTTGAGGTTGTGCACATTCCGGTGATCTGGCATTCCAAGTTT
GATCGGCATCTTGTTTCAAGAAGCCCTAAGCAAGAATTTGGGGTAGTGCCGGTCGCACTGCATGCCTGTCAAACG
AACCAGGGAACGGCGCTTATTCTGCAAATCCACCATGCATTGTACGACGCTGTCAGTTTACCCCATATACTGAAC
AGACTTGTTACGCACTGCGGCCAAGAGGATGTTGTCAAACCAAACCCCGACCTTGATCTCGCACAGCTCGTGGCA
TTCCAATATGTTCATTCGCCCGTGGATGTCCGGCGGCAATTCTGGCAAAAGTATCTAGGCCAAATCTCAACGGCG
GTAAAACGAGGGCATTGCTTCGGCTCTGTGCAACATCACTACCGACCGGGCCTGGTTTCAAATATGGCCAGTGTC
GAAAAGGTTGCCAAGCGCCGGGGCCTTAGCATTCAGACCGTCTTTTTAGCCGTCTATGCACGAGTGCATTTGCAG
CAATTCGGTGCAGCTGAAACCACAAATGGCGCAGGGTCTCGCAGGCGGTTAACTGTTGGACTGTACCTTGCCAAT
CGATCTCATTCCATTGAGGGTTTAGCCGAATCTGTTATTCCCACCGTTAACATTGTTCCACTACGACTGGATGAC
AAACTCAGCGATTCCAACGACACCCTCCTTGACGCCGCCCGCAGAATTCAGACTGAAATCAACGAGATCAGCCGA
CCCGAATATTCGGGCGTTTCTCTCCTGGAAATTGCCGAATGGACGGGCATCCGAATCGACACCTGCGTCAATTTC
CTGCGACTCCCTGAGCAAGAATTGAAAGTACCCGGCAACTGTGACCACGCAAAGTTTTCTTTTACAGCAATTCAA
CGCGAGGAGTTTGAAGATCTTAGCGGGGCAGCCCCGGTTTCGAAAAATGACCCAATTCCGATTAATGGCAATGGT
GTAGCGCCACCTGGTGCAGCCGAGACGATCCCAGGCCTCGAGCATCCAAGCGCCTCAACGGCGGCTACTCAAGAC
ATCTTCCAGTCTACGATCGACGTGGAAGCCGCCATCCGTAATGGTCGGTTAGACTTTGGGCTTTTCGCACCAGAA
TCTCGTCTTGACCGAGATACAGCGGAAACTGTGATCGGCGCTATGCAACGGGAGATGTCGGCATTGGTGACAGGC
TTCGAATCGATATAG
Transcript >Pro_DTO377G3_2|g4132.t1
ATGGACCGATTCACTCAATTCCCTGCCGTCAATGACGATGGTGATGATGTTCATATTGTACCCTGGCAGGTGGAT
GCCCAACTCCCCTCGGAGATACTTGCTTTGTCATGGGCAGTCTTGCTACGTGCATTCACAACGGATGAGAATCCC
GTCTTTCTATTGAATGGTGCGCCAGTCAAGGCAGATCTGTCTGCCCAAACGGTTCAGCCAGCACATCTGGCTGCC
GTATCAGATCTCTCAGTCAAACACACTGCCATAGTGCTGGGAGATCCTCCGTCCGATGATGATGGACATCTCCCG
GTGTTGCAGTGGACCCTGGACCCCACGACTCAGCTGGGAACTTTGCGTGCGGCTGGAGGCATGGATGCTACTTTC
CTGTACCAGTTGGGCAACCAGCTGAAGGTGATCGTGCAAGAGCAGGCTGTTCTAAAGGGTATACCGGTGACAGTG
TCTGCCACCGAGGTTCCTGATCTAGCCATTTCAAATGCCTCCCCCTCCACATTACCAGGGCCCCGGCTTCTACAC
GAGCTTGCCCTGCGTGAGCTCAACAATTCAAACCATGCCATTGAATTCCTCAAGGCGGATGGAAACGTTCAGTGC
CTGTCGTACCATGACTTGGACCGGCTTTCCTCGGAGCTGGCGAGTAAAATAGCTCGTGCTTCGACGACCTCTCCG
GGCCTACAGAAGGTTGTGCCAGTACTTTTGCCCCAGTCTGTGGAATTGTACATTTCATGGCTGGCTATCCTCAAG
GCTGGCGCAGCTTTCTGCCCCTTGAACACCGATGCACCAACAGATCGCATCGAGTTTATCCTGCAAGATGTGGCC
GCATCGGTGGTGGTCACAAATGATGCTCTTGTAACAAGGATACCGCTGAAAGAGCATATTTCTATTCTCACAGTG
GACGATCTTCAAACCAACGCCGATATCACAGAGCCATGCGCAGAAAACAGCACTTCCACTGATCTGGCGTATGTC
ATGTACACATCTGGCTCTACGGGCCGCCCTAAAGGCGTCGGGGTGTCCCATCTTGCTGCCACCCAATCACTCCTT
GCTCATGATGATTTGATACCCCCTTTCAAGCGCTTTTTACAATTTGCATCTCCCACCTTTGATGTTTCTGTGTTT
GAGGTCTTTTTCCCGATGATGCGAGGGTCAACCCTCATCGGGTCTGAGAGAGAGAATATGCTTCTTGATATTTCC
CATGTGATGACGACGATGAGAGTCGATGCCGCTGAGTTGACCCCAACGGTGGCAGGAGAGTTGCTGCGCACGCGA
GCCGCCGCTCCGTCTCTCCGAGTGCTCCTCACAATTGGCGAGATGCTTACCAGACACGTGGTAGACGAGTTTGGC
CAGTCCGAGGGCAGGGGTGGCATTCTCCATGGAATGTACGGGCCCACCGAAGCAGCAATCCATTGTACCGCGGCC
ACCCATTTCCAGGCCAAGGATCCTGTCAATATGATTGGAAAGCCCTTCAAAACCGTGTCGGCATACATCATGCCA
CTCCCTTCCGACGAGCCATCCTCCAAGGAGCTTCGTCCCCTTTCACTAGGCCAAATTGGAGAGCTTGTGGTGGGT
GGTCCTCAATTGGCAGACGGGTATATCAACCGACCCGAAGAAAATGCCAAGGCTTTTATAGACAGTCCGGTGTAT
GGCCGACTCTATCGCACGGGAGACAAAGCCCGCATACTCCCCACTGGAGAGATTGAGTGTTTTGGCCGAATTTCC
AACGGCCAGGTGAAGCTGCGAGGTCAGCGGATAGAGCTAGGCGAGATTGAGCATGTTATCACCAGAGCCTCTGGT
GTCCGCAGTGCTGTTACCATGGTTATCGACGGGAACTTAGTTGCATTTGTTTTGGTTACCGACAAGGGAACGACG
GACATTAGTCTCCGAGATGTCTGTCGTCGGCTGTTGCCTCGCTTTATGATCCCCGGAGAATTCCTGCTCGTCGAC
CAATTCCCCCAACTTCCCTCGGGCAAGATCGATCGTAAAACACTAGAAGCCAATTTCATTCGCCACCGAAGCACT
GCCCTGGCTTTTGATGATCAACCCTGCCGAGACGAAAAAGAGGAGTCTATCGCCTCAAGCGTAGCCGATGTGCTA
GGCCGACGACTCCCGTCGACAGAGAGCCTGGCAGCAGCAGGTCTTGATTCGCTAGCAGCAATCCGTCTCGCGTCT
CATCTCTTGGATGCAGGAATTCGGCTAGGTGTGGCTTCCTTGTTGGAGGCCGACTCAGTGGACGGAATCTGGCAA
CTTGCCACCAGTCTTGAAGCTATGAGCCCAAATAATGATACGCAAGCAGCCTTGCAAACCATTCTTCAGCTTGTT
TTAGACGCAGGTGCAGCAAGGGTCGACTCGCTGGGCTTGAGCGATCAGGTTTCGGACGTCATACCGTGTAGCCAT
ATCCAACAGGCTATGATCTTGGAGACTGTTCGAGATAACAAGGCATACTGCAACTGGATTGAGCTGGAATTCGAG
CCCTCGGTCAGTTCAACTGCGGTAAAGAATGCATTTGGTCAACTGGTGGACCACAACCAGATCTTACGGTCCGGA
TTTGTGGAAATCGGCCTCAAAGATCACTCATATGGTCGATTCACCTGGAATACTGTCAATGACCATATTTCCCTG
AAACATGAACTTGAATACGATTTGGGCCTGAGTGCGGGTCACGATGTCTTGAACCCTTTTCGAGTCCAGATCAAA
GAAGGCAAGGACCATCTCCGCGTGCTGGTGCATATCCATCATGCTCTTTATGATGGATGGTCTTGGCAAATTATG
TTGAAAGATCTCAGAAGTATCTTGTCCGGAGAGGAGCTCACTTCCAAACCGCCATATAACATCGTCGCAAACTAT
TTCATTGAGCACAAACTGGACAAATCGGCAATAGAGTCCTCAGTGTACTGGCGTGAACAACTCCAAGGTCTTTAT
CCTGCAACTTTCCCTATTTTCCACGGACATACAGATATAATACATGCTACCGACAAGGCTACTCGCGTGCTGGAC
ATATCCGTATCAAAACTCAACCAAGTTTCCCAGCATCTTCGCGTGAGCCGGCAAACCATTTTTCAAGCCGCGTTT
TGCTATATTCTCTCTTCCTACATTGGAACCGGTGATATCACATTTGGAACTGTCTTTTCAGGCCGAACTCTGCCC
TTGAAGGGCATTGAAACGGTTCTCGGGCCTTGTATCAGAACTTTGCCTACGCGCATGAACCTCGACAAAATGCAG
GACGTGACCGATCTTCTTTTGGCCATCCAGAATATGAACCGCAAGTCACTCGAGCATGGCAGTCTTTCTCTTCAG
GATATCAAGAAGGCTTCTGGTATCGACTTGGATCGCAGTCTCTTCGACACAGCGCTCGTGTGGCAGGAAAGCATT
TGGTCAGATGATGACCAGGGCTCGGTGTTCCGGGAAGTTGGAGCGGGGGAGTTTTTAGAATTTGCGCTGTTGCTG
GAGTTTGAGCCGCGAGAAGAAAACATCTTTGCTCGGGCGACATATCAAGAGTCGGTGCTACCAGTTGAGCAAGCT
ATGATACTACTCGAGCAGATTGATTCTGTGGCCTCGGTCTTGATTGACAAGATTAAGCTTCCAATCCAGGAGATT
CGATCGTATCTTCCCTCGTCAACGCTGTCAATTGAACATGCAACATTACGCGATCAAGTCAATTTGCCAAGCCTG
GCATCTAGCGTCGAGATGATTGCTTCTACAGACCCGGACCGGGTAGCGGTTGAGTTGATGCTCTGGAAGTCAGAG
AATTCTACTTCGTTGATGGAAAGCATGACCTATAGTCAACTAAACTCCCGAGCCAATGGCTTTGCACACTTCTTG
CTCCATATCGGAGTGACAAATGACGATCTAATAGCCATTCATCTGACAACGTCTCTTGACTTTTATGTTGCTGTG
CTTGGAGTCGCCAAGGCCGGTGCTGGTCTCCTCCTCCTTCCCCAGGCTTCTTCGCAGAAAATCCATTCTATTCTC
TCCACGGCGAAATCCAAGTTCTGTATCATCGACCACTTGACGGAAAGAGATCATAGCTTGGATTCTCTGAAGTCC
GTCCAGCTGATTCATCTCTTTTATTCACTGGATGTTTACCATGAGTTTAATATTCCATATACCAGTAAAGGGTCT
GACGTTGCCTATGCTGAAGTGTCGCTAATTGAAGATGACTTGATTGAAAACATCGTCATCTCACGGCAAAACCTG
CAGAGCAATATCAATGCTCTGTCAGACTCGTATCCAGCGCCAACCGGATCGAAAATGCTATCATGTCTTCAGGGA
TCAGGTGCATCTATTTGCCAGGCATTCTTTGCTTGGCATGCTGGCATGACATTGTGCTCAGCTACAGAATTGATA
ATGATGACTCGTATCGAGCAAGCCTGTCAAGACATGAACATAACACACCTGCACTTGCCTCCCATGCTGGCCTCC
CGTATTGATCCACAAGCCGTCCCCAGTGTGCAATATCTCCTCTCTTCTGGTGAAGAAATGACCCTTAAGCTCCAT
CACAATTGGGCCGGCAAAGGTCTGAATCAAGCATACAGCAACCATGCACTGACTCACGCATGTACTCTCTGTCTT
AATATGCAGGCATCGACCCATGTTCGAAACATTGGTAGACCCCTGAAGAACACATCTGCCATGATTGTAGCAGAT
GGAGATTCGCTCAGCCTTCTTCCACGCGGTGCCATTGGAGAGCTATGCTTCGGCGGGGATCAAATTGGGCGCTGT
CTACCTGACTCCAAGTCGCCAGTTACTGGGCGATTCGTTGATCATCCTGAGTTTGGTCTGATCTATAGAACGGGT
GACTCTGGAAGGCTGCTTCCTGATGGTACACTCATTCTTTCCCGAAGCTCTGGCCTTGCTCAGTCGTATGCTCCG
TCTATTGATCTAGACGGAGTTGATCGTGCTCTGATGTCTTTAGAAATGGCAAAAGAAACAGTGAGCATGATTTTG
GATGAGCCGACACTGCGATTGGCAGTGTTCTGGGTTCCTTCAAAGAAATGCTCAGGTTCCGTGCAAATCGAGAAG
GCTACGAATGATCTTTTCAAGGAGCTCACCAAGAAACTTTCTTCTTCTGACCTTCCATCCCTTCTTGTTCTCGTT
GACACGATAGATCTCACTAGGTCTTATAAGATTGATTACTTCAAGCTGAGGCAACGGTTGGGGCAACTGATAACG
AAGGAGCTTGCGATATTTTCACCAAAGCCTAATACCGATACTAGTGACAGTTTCACTGATCTTGAGAAGACTATC
TCTGCCGCGCTATCGGCAGTCACTGGCACCGACCAAACAAACGTCCGCAAACACACATCTTTCTACAGACTGGGT
CTGGACTCTCTTTCTGCCATTTCCTTCTCGCGAAAGCTGCAGGAGTCTGGATGTGGAAGGCTTGCCGTGTCCACA
ATCCTGCGCCATAGCTCTATTTCTCAACTTGCAGCTGTCATTACTGCCACGACCAACGGGGATCAGCCCGAAAAT
GCGGTGCCCGCACCACCAACAGTGTTCGATGAAATCTTCACTCATCAAATAGAAGATGAGTTCAAAGCTACAGCC
ATAAATGTTCAAAGCATTTACCCTTGCACTCCACTCCAGGAGGCTATGCTTGCAGCTGAATCTGGTGATCATTCG
GCTTATTTCAATCACCTCTTGCTTCTTGTGCATACCAATGCCGAGACCATGAGAGCAGCATGGGCTAAGATGATG
CAAAGACAAGGCATTCTTAGAACTTGTTTCACGCAAACTAATGATAGGCGGTTCGCATATGCTCAGGTTGTACTG
GACACATCGGTCTTACCGTGGTCCCATATTGAAACTTCCTCTTCTGAGCTTGAGAATGTCATCAAGGAAAACAAG
TCCAAGTTCGAGGGTATTTCTCCTGTCAACGGCCAGTTGCCTTACTCATTGACTTTGATAACCGATTCAACTGCG
CAGCAGACATATCTTCTACTGTCCATCCATCATGCACTGTATGACGGAGAAGGTATCGCCCAGTTATTGCAAGAG
CTCCAGCTGTTGATTTCAAGTCAAAAGTTGCCAAAGAACACTCCATTCCGCAACTTCATCGATTACATGACCTCT
GTTGATTATGGCTCGTCGGATGAATACTGGGACCAGTACCTGTCCGGTGTTTCACCGACCCTCCTTCCCACACCC
GGGCCCGCAGCCAATGCAAATGAGTCGGCATCACAGCAGATCCATACATCCCTCAATGGCTCTTTCGTATCATTC
AGGCAAAACTGCAAAGACCTCTCCGTGACCCCTTTGAACATCTTCCATGCTGCATGGGCCAGACTCCTCTCTCTA
TACACCGGTTCATCCGACGTCTGCTTTGGCAATGTCTTCAGCTGCCGAACCGTTCCCTTGGATGGCGCAGATCGG
ATAGTCGGGCCTTGTTTCAACACACTCCCAATTCGAATCAAGTCTTCTTCAACTTCAACAAATAGTGACATCATG
AAATTGTCCCAAAAGAGCAATAACGACATTTTGCCTCACCAACTCAGCCCTCTCCGGCGTATTCAACGACGTATT
CTTGGCGATGGCTCTCGCCTTTTCGAGACGCTCGTCATTTTCCAGAACAGAAATACAGATCTCGATTCCAATATC
TGGGAACTTCTTCAGGACGAAGGAAACATGGGATTCCCCTTGATATGTGAGATCATCCGCGACGAGTCTAAAGAC
AAAATACAGATCTGCCTCCACTTCCAAGTATCGTATATCTCACAAGCCGTGGCTGAGAAAATTGCGCGGGACTTT
ATAGTCCTTGTTGGACACATCATTCAATATCCGTCTGCTCAGGCATCCGATAAGCGGCTATTAGGGGCAGACATT
CCTCGAGTATTTGAACATAACGTGTCTAAGACGTCAAAATCTGTTCAGTTCCCCACAAAATCTCGCCAAAAGCTC
CCATGGTCCTATCGAGAGGAGATTGTTCGCGACCTTCTTTGCAAATTTTCGGATGTCGACTCGGATAATGTGTTC
CAGGACACAACGATCTTCCAACTTGGCCTGGATAGTATCAACGCTGTTCAGGTATCGGCGAAGTTGCGTGAGTTA
GGGTATAAGATCTCATCTGGTGATATTCTCGAGGCTGCTTCTATTGATCAAATCGCTTCCCTTCTTACTTCCAAC
GCGAAGATTGTTGAGGAAATCGAGTTCGACTTTGGACTTTTCCAAACCAATTATTTGCAGTCTGTTTGCCAGCAA
CTTGAGATTTCTTCGCAAATAGTGCAGTCTCTGCGCCCTTGTACGCCAGTCCAAAACGGAATGCTGGCAATTTTT
ACACATTCACACGGTGAAGTGTACTTCAATAGAATGACCTTAAGGTCCTCAGTACCTTTAGATAAGAAGGTCTTG
AAAGAAGCATGGTCTAAGGTCATGGCTCAGCATGAGATGCTTCGAACAGGATTTGTTGAATTGCGCGATCAGAAT
AATCCTTTTGCTATGATAACTTACCATGAATACGGCAAATTACCATGGTACGAGACCTCGTCTTCCATGGAAGTC
ACTTCTGGTGTTCAACAAAGGCACGCTTTGGAAAATCTCCACCAGCCTCCATGGAGCATTGAAGTCGAAGTAGGT
GACCACACCAGTATCATGCATTTCTCTGCATTGCATGCTATTTATGATGCTCAGTCTCTGGCCACCATACTTTCA
GACGTCAGAGCAGCATATGAAGGAAAGGCTCTGGCTATGCCGGCCCCAGTCACCAAAACTCTCGGCCCTATCCTT
CTTGAGAGTAAGAGCCAGAGCGAATCAGCGCAATCCTTCTGGAAGGGACTTGCCCCAGAAGTGCAGCCCTCCAAA
TTCCCCGACTTAAATCCCATCCGCACAAACGAGCGAACATTACTCACCACCTCCATCCGTTGCATACAGTCTCGC
AAGGCTTTTGAAGATGCCTGTCGAGATATCGGCGTGACACTACAAGCAGCGGGGCAAGCCACGTGGGCTCGCTTG
CTCTCTGCGTACACGGGCGAGTCCAACGTCACTTTTGGAACCGTGCTTTCAGGTAGAAACTTGTCCGCTGATGCT
CAGCATGCGGTATTCCCGTGTTTGGTCACAGTGCCGACGCCCCTGCATATTGAGGGTTCCAACCGACAGCTTTTG
GACTGTACGTTGAAGCGAAATGCTTTATTGGTAAAGAATCAGTTCGCGCCTCTGTCGCATATCCAGCGTTGGCTA
GGTAGCGATGAGCCACTCTTCGACACGCTGTTTGTCTATCAGAAGTTTAATTCTGATGCCGTTGGTGCTGATAAG
TGGGACATCATTGGCGAGGAGACGAATATTGATTATCCTGTCTCTATCGAATTGATTCCGCACTGGAACGATCTT
CAGATTTCGTTGAGCTACCGGGGCGATCTTGTACCCATGGAGCAAGCAAAGATCCTCTTGAATCAGTATGAAAGA
TTATTGCAAGATACTGTCTTCTGTCCAGATGTCAATTCCACCGATTACGACTCTGTGGGTAGTAGTCTGCTATCA
ATTACTCCTGCCAAAGAAGCACCAATTCCTACCACGGTTTCTTTGCTACATCAATTCGTCGAGACGAACGCGATC
AATATTCCCGAGAAGATTGCGTTTGAATTTGCTTTCGGTGACATTGCAGAAAATCTGCAGAAGAAGACATGGACT
TACCGTGAGTTCAATGAATGTGGCAATCAAATTGCGCATTTCCTGCAGGCCAAGGGGGCTATTCCTGGTGGAATT
GTGGGAATATGCTTCGACAAGTGCCCTGAAGCCTCCATGGCGATTCTGGGTATTATGAAAGCTGGATGTGCATAT
CTGGCTATTGACCCTGGTGCTCCTATCTCTCGTAAGCAGTTCATGTTAGAGGACTCGGCTACCAAGATCCTCCTT
TGCAATCAATCGAAGATGGCGGAACTAGATGGTCTTCCAGCTATTGATGTCCAGGCACTTGATGAGCCTGGGCTT
CTTGACCGGGTTTCAACAGGGGATATCTCACTTTCCCGTCCTATCCAGCCAGATGATACTTGTTATTGTCTGTAC
ACATCCGGTACAACTGGAACACCGAAGGGCTGCGAGATCACGCACGATAATGCCGTGCAAGCAATGCTGGCATTC
CAACGATTGTTCGCAGGACACTGGGATGAAGAGTCTCGGTGGTTGCAATTTGCCTCCTTCCATTTTGACGTCAGT
GTTTTGGAACAGTACTGGAGCTGGAGTGTTGGAATTTGCGTCACTTCCTGTCCACGCGATTTGCTGTTTGAGGAC
CTGACTGGAACGATACAAAAGCTTCGAATTACGCATATTGACCTGACGCCCAGTTTGGCAAGACTAGTCCATCCC
GATGAAGTTCCGTCGCTTTGTCGGGGAGTCTTCATCACCGGCGGAGAGGCCCTGAAACAAGAAATCCTAGATGTC
TGGGGCAAGCATGGTGTCATCTACAATGGATACGGTCCTACTGAAGTTACTATCGGATGCACCATGCTCCCACGG
ATGTCTGCCAATGACAAAGCCTCAAACATCGGGCCTCAATTCGATAATGTGGGGTCATATGTCTTCAGCCCCGGT
ACGACGACACCAGTCCTACGCGGCAGCATAGGCGAACTCTGCGTCTCGGGACCTCTCGTTGGAAAGGGCTATCTG
AATCGAGTGGAGCTCACCAAGGAAAGATTCCAAGAGCTTCCCGAATCTGGCGATCGCATCTATCGCACTGGCGAT
CTTGTGAGAATTTTGCACGATGGAAGCTTCCAGTTCCTCGGTCGCATTGATGACCAGGTCAAGCTCCGCGGACAG
CGACTTGAGATTGGAGAAATCAACGAGGTCATCAAACAAGCTACGCCTGAATTGAACGAAGTCGCTACCCTGGTC
ATCACGCACCCCAAACAATCGAAGGATCAACTTGTCTCCTTTTTCACGACTGTCACTGCAGATAAGAAATCTCGT
GCTGTCGACGTTGGAGTCCGATATTCAGAAGAGGACCGCGCCCTGCTATCGAAGATCAAGGGTGCTTGCCGCACT
CATCTTCCTAGGTACATGGTGCCTACACATATCATCCCGATGACCCAATTTCCGCTGTCTGCCAATAACAAGGCT
GATATGAAAGTCTTGAAGAGTATCTATCAGGAGCTTTCGCTAGAAAACATTCAGAAATTGAGCTCGATGAGCGTT
AGCCAGTCTACTGACAGTGTCCAGGAACAGAAGATCATATCTGTCCTGGCGAGGTTTATTGGTTCCTCTGAGGAG
AAGATCTCATCATGGTCCAGTATCTACGAGCTTGGTCTGGATTCTATATCTGTTATTGCTTTCTCGAGAAGTCTC
CGGGAGGCTGGGTTTTCTCAGGCTCAGCCATCGACCATCATGAAGTACCCTACAATTTCCGGCATGACGTCGGCT
CTACAGGTGCCTATCTCATCTTCTGTGTCCGTGGAAACCTTCCAACGCAATGCCAAGCAAGGCATCGAGGCTTTC
GCTCACAAAAACTCCCACGCTATCATCGAGCATATTGGAGCCCGCTACGGTGACATTGAAAAGATTGCGCCCTGC
ACCCCGCTTCAGGAGGGTATCATATACCACTACCTGGCTAGTAGCACGCCGTTGTACTGCTCATCTTTCACTTTC
GAGCTCGACCCTTCAGTGAACCTCGAGAATTTGCGCGCGGCTTGGGATCAGGCCCAGAGAGACGTTCAGATGTTG
CGCGCCAGATTTCTGCCATCTCCAGACGGCTATGCCCAAATTGTCATGAAGAAAGACGCCCTTCCTTGGTTCCTT
GCTACGGCCGGTACCAATCAAGAGATTGATGACTTGCGCAAAGAACGACATGACCACTGGATTGCCCAGCTCGAC
GGTCTTTCATCCAATCTATGGGAAGTCGGAGTCATCTCTTCCCCCAAGATATCGGTAATGTGTTTGAACATCTTC
CATGCTCTCTATGATGGAAACAGCCTAGTCCTGCTCCTCGAATTGGTTGCCCGAAGTTATCTCGGTCAGATCGAG
AGTTCGGAGTTAATCCCGGAATTCCTTGATGTGTTGCACTTGGGTCCCCTTTGTAAAAACCCTGCTGCAGAGGCG
TTCTGGAAAGTTCATCTTGCTGGCTGTCGTGATCGAGCTTTCGCCGAGGACGGCCAAGTAGACAGCGCGCCAATT
CTGCTTAAAGCTCAAATGAATGCGACAGATCAAGTTGACCATCTTCGCCGGTCTCTCAATGTTACAGAGCAAGCT
GTCCTTCATGCCTGTTGGCTTCTTACTCTCCAGCAACAATACTCCTTCGTGCCACCACTTGGTATCATTGCCTCA
GGCAGGACAATCGATGTACCAGGCATTGGCGACGTTATTGGACCGCTGTTCAATACGATCCCCAGCAATGTCCAG
CTGCATGGCTTGGAGTCTTGGTCTGATGTCGCTCGGCGCTGCCATGACTACCAGGTGTCCATGATTCCTTTCCAA
TACACCGCCTTGCGGGACATCGTGAAATGGCTCGGAAAGAACCCCGACGAGCGGCTCTTCAGCTCCTTGTTTGTC
TTCCAGAGGGAAGATGATAACGACGAATCGTTCACAAAAGATCTTTGGTGTACACTTGACTCGGAGGCCCAGCAT
GAATACCCTCTGGCCTTTGAGATTGTACGCAATAGCAAGCAATTTTTTACAGCCACTATTGCCGCAAAGAGTCAT
GCGGTATCGTCGGAAGATGCTCAGCAGATGTTATCTAAGTTTGAGCAAATTCTTTTTGAGTTTGCGCAAGACCCC
AAAAGAGAGTTGCCCAAGATAAATGGGGTGTCTCTCGCACAAGTTGTGGCGGATGGTGAAGTGAAGGGACACCAC
GAGTCTCCAAGAACCCCAGAACATACCAATGGTGAACATACCAATTTCGAACATATTAATGGCTCTTTGTTTGAA
TGGACTTCCCAGGCTTGCATAATTCGCGACGTGATTGAAACCCTTGCGGGGGTGGAGCCGCAATCCATCAACGAG
AACACATCAATCTTTGAAGTTGGACTTGATAGCATCGATGCCATCAAAATCTCCTCGCGGTTGAGCAAAGCCGGC
ATCAAACTTCCTGTGAGTTCCATCATGCGCCATCGTACAGTCAAGGCAATGAGCGAGCAACTCTCAATGACAAAT
GGTCATACCAAGGATGGGACATTATCATCACTTAATCGGCTAGAGAAATTGTTGACCGAGTTCCTCGGGGCTGAA
GGTCTTCTCCCCCCGAGCGCGATTCGAGTCTTACCAGCCACACCCATCCAAGAAGCTATGGTCGCTGAAATGTGT
GCCTCTGGGTACAAGCATTATTACAACCACGAGATCCTCGAGCTTGAGCCAGATGTAGACATTGAAAAGATGGAG
CGGGCATGGAGAGCTGTCGTTAGAGCTCACCCTATCCTCCGTACTTCATTTGTTGAAGTCTGGGATCCGAAGATT
CCTGTTTCATACGCCCAAATAGTTCACAACGAGGATCAAATTGACCTCAAGACTATCCATCTACACGGCGTCTCC
GTGGAATCCGTTATAAAGACTCAGCGCTCAAGGGTCCACAATAAGCCGGCAGGCTGTCCCTTGCTCTCTATCACC
ATTGCAGTGGAAGGGGATAGGCGGTACCTTGTTTTGTCAATTTCGCATGCTCTCTATGATGGTTGGTCAATCAAT
CTGCTCCACGAAGACGTTGCCAAATCGTATGCTGGTGTAGAGTGTTCTCGCCCGCCAGCCGATGAAATTCTCGGG
CAAATCATTGCCTCGTCTGGCGACGAAGCCCTCAGATTCTGGCGAGCAACGCTATCCAAATTCACCCCGGTGTCA
TTCTCTCCTATGGAACATGCGGAGAATAGCTCGGTTGTCGTTCACCGAGCAGAACAATCATTATCCGTTCCAATG
TCCAAGGCGGAGATGTTCTGCAAACGTCATGGCATTACCCTCCAGGCGCTTCTTGTCGGCTGCTGGTCTCTTGTC
CTTGCTAGGCATGTCAAGAAGCTAGATGTGGTATTTGGGCTTGTCCTTTCCGGTCGGAATGTGGCTAACTCTGAG
CACGTGATGTTCCCGACTATGAACACTGTCGCCATGCGAGTTATTCTTCATGGGACGCGGGTAGAATTGGTGAAA
TATGTGCAGGAGGCTCTCCTCGCCATGTCGGAGCATCAGCATTTCCCGCTTCGGCGCGCCAGACCAGATACGGGA
TCGCGGGCATTGTTCGATACGCTTTTCATGTATCAGAAGAGACCGGTCGAAATTGTCCAGAATGAGCCTAGGCAA
GTCTTATATAAATCTACTGGCGGAGCAGCCGAAGTTGAATACCCTGTTTGCGCTGAAGTTGAAGGTGTCGGGGAG
GATCTAGTTGGACGAGTTGCTTGTCGTGGAAATGTTACTGGGTATCAAGATACTCTTGTGCTGTTGGAGCAGATG
AGCGATATCCTTTCGTCTATCATCGATGGTCCATCTGAACAGACTGTGGATTTTACCAGTGAGGGAGTGAAGATT
TGTGGAAGCGCCGCTTTCCAGGATGAGTCTGAACAAAATATCGAGCCTGAAGCAGTGCCCGGGACACTCGATCAG
GCGGAATGGTCGCCGATTGAGTCAAAGATCCGCAAAATTCTTTCTATTGCATCCGGGGTACCTGATGATTCCATT
GACAAGAGCTCCACCATCTTCGAGCTTGGCCTGGACAGTATCAGCGCCATCAAGGTGGCTGCACTCCTGAAGAAA
CAGTCCGTCAAGCTTGCGGTCAGTGACATGCTTCGGGCTGGTACTGTTGAAAACATGGCCAAAGCAGCCAACAGC
GGCCTAACGGAGGTCTCGCTCACAAATATATCAAGCATTCTCCACGATTCACTCGATGGCATCGATGTGGCGGGA
CTGCTACAGTCACATGGTATTGATTTGCAACTAGTACGAAAGGTGTTCCCCACAACTGCAGGGCAAACCTATTTC
CTCTCAATGCACATTCTGAATCCAGAGATATTCTATCCTGAGTTTTACTATCTGACATCACGACAATTGAGCCCT
GAAGTACTCGATCGGGCCTGGGCTCGGGTCATAGACCAAACCCCAATGCTTCGGACGGTATTCGTTCCCACTTCC
GACTCTCCGCTATTACCCTATATGCAGATCGAGTTTGAGGTTGTGCACATTCCGGTGATCTGGCATTCCAAGTTT
GATCGGCATCTTGTTTCAAGAAGCCCTAAGCAAGAATTTGGGGTAGTGCCGGTCGCACTGCATGCCTGTCAAACG
AACCAGGGAACGGCGCTTATTCTGCAAATCCACCATGCATTGTACGACGCTGTCAGTTTACCCCATATACTGAAC
AGACTTGTTACGCACTGCGGCCAAGAGGATGTTGTCAAACCAAACCCCGACCTTGATCTCGCACAGCTCGTGGCA
TTCCAATATGTTCATTCGCCCGTGGATGTCCGGCGGCAATTCTGGCAAAAGTATCTAGGCCAAATCTCAACGGCG
GTAAAACGAGGGCATTGCTTCGGCTCTGTGCAACATCACTACCGACCGGGCCTGGTTTCAAATATGGCCAGTGTC
GAAAAGGTTGCCAAGCGCCGGGGCCTTAGCATTCAGACCGTCTTTTTAGCCGTCTATGCACGAGTGCATTTGCAG
CAATTCGGTGCAGCTGAAACCACAAATGGCGCAGGGTCTCGCAGGCGGTTAACTGTTGGACTGTACCTTGCCAAT
CGATCTCATTCCATTGAGGGTTTAGCCGAATCTGTTATTCCCACCGTTAACATTGTTCCACTACGACTGGATGAC
AAACTCAGCGATTCCAACGACACCCTCCTTGACGCCGCCCGCAGAATTCAGACTGAAATCAACGAGATCAGCCGA
CCCGAATATTCGGGCGTTTCTCTCCTGGAAATTGCCGAATGGACGGGCATCCGAATCGACACCTGCGTCAATTTC
CTGCGACTCCCTGAGCAAGAATTGAAAGTACCCGGCAACTGTGACCACGCAAAGTTTTCTTTTACAGCAATTCAA
CGCGAGGAGTTTGAAGATCTTAGCGGGGCAGCCCCGGTTTCGAAAAATGACCCAATTCCGATTAATGGCAATGGT
GTAGCGCCACCTGGTGCAGCCGAGACGATCCCAGGCCTCGAGCATCCAAGCGCCTCAACGGCGGCTACTCAAGAC
ATCTTCCAGTCTACGATCGACGTGGAAGCCGCCATCCGTAATGGTCGGTTAGACTTTGGGCTTTTCGCACCAGAA
TCTCGTCTTGACCGAGATACAGCGGAAACTGTGATCGGCGCTATGCAACGGGAGATGTCGGCATTGGTGACAGGC
TTCGAATCGATATAG
Gene >Pro_DTO377G3_2|g4132.t1
ATGGACCGATTCACTCAATTCCCTGCCGTCAATGACGATGGTGATGATGTTCATATTGTACCCTGGCAGGTGGAT
GCCCAACTCCCCTCGGAGATACTTGCTTTGTCATGGGCAGTCTTGCTACGTGCATTCACAACGGATGAGAATCCC
GTCTTTCTATTGAATGGTGCGCCAGTCAAGGCAGATCTGTCTGCCCAAACGGTTCAGCCAGCACATCTGGCTGCC
GTATCAGATCTCTCAGTCAAACACACTGCCATAGTGCTGGGAGATCCTCCGTCCGATGATGATGGACATCTCCCG
GTGTTGCAGTGGACCCTGGACCCCACGACTCAGCTGGGAACTTTGCGTGCGGCTGGAGGCATGGATGCTACTTTC
CTGTACCAGTTGGGCAACCAGCTGAAGGTGATCGTGCAAGAGCAGGCTGTTCTAAAGGGTATACCGGTGACAGTG
TCTGCCACCGAGGTTCCTGATCTAGCCATTTCAAATGCCTCCCCCTCCACATTACCAGGGCCCCGGCTTCTACAC
GAGCTTGCCCTGCGTGAGCTCAACAATTCAAACCATGCCATTGAATTCCTCAAGGCGGATGGAAACGTTCAGTGC
CTGTCGTACCATGACTTGGACCGGCTTTCCTCGGAGCTGGCGAGTAAAATAGCTCGTGCTTCGACGACCTCTCCG
GGCCTACAGAAGGTTGTGCCAGTACTTTTGCCCCAGTCTGTGGAATTGTACATTTCATGGCTGGCTATCCTCAAG
GCTGGCGCAGCTTTCTGCCCCTTGAACACCGATGCACCAACAGATCGCATCGAGTTTATCCTGCAAGATGTGGCC
GCATCGGTGGTGGTCACAAATGATGCTCTTGTAACAAGGATACCGCTGAAAGAGCATATTTCTATTCTCACAGTG
GACGATCTTCAAACCAACGCCGATATCACAGAGCCATGCGCAGAAAACAGCACTTCCACTGATCTGGCGTATGTC
ATGTACACATCTGGCTCTACGGGCCGCCCTAAAGGCGTCGGGGTGTCCCATCTTGCTGCCACCCAATCACTCCTT
GCTCATGATGATTTGATACCCCCTTTCAAGCGCTTTTTACAATTTGCATCTCCCACCTTTGATGTTTCTGTGTTT
GAGGTCTTTTTCCCGATGATGCGAGGGTCAACCCTCATCGGGTCTGAGAGAGAGAATATGCTTCTTGATATTTCC
CATGTGATGACGACGATGAGAGTCGATGCCGCTGAGTTGACCCCAACGGTGGCAGGAGAGTTGCTGCGCACGCGA
GCCGCCGCTCCGTCTCTCCGAGTGCTCCTCACAATTGGCGAGATGCTTACCAGACACGTGGTAGACGAGTTTGGC
CAGTCCGAGGGCAGGGGTGGCATTCTCCATGGAATGTACGGGCCCACCGAAGCAGCAATCCATTGTACCGCGGCC
ACCCATTTCCAGGCCAAGGATCCTGTCAATATGATTGGAAAGCCCTTCAAAACCGTGTCGGCATACATCATGCCA
CTCCCTTCCGACGAGCCATCCTCCAAGGAGCTTCGTCCCCTTTCACTAGGCCAAATTGGAGAGCTTGTGGTGGGT
GGTCCTCAATTGGCAGACGGGTATATCAACCGACCCGAAGAAAATGCCAAGGCTTTTATAGACAGTCCGGTGTAT
GGCCGACTCTATCGCACGGGAGACAAAGCCCGCATACTCCCCACTGGAGAGATTGAGTGTTTTGGCCGAATTTCC
AACGGCCAGGTGAAGCTGCGAGGTCAGCGGATAGAGCTAGGCGAGATTGAGCATGTTATCACCAGAGCCTCTGGT
GTCCGCAGTGCTGTTACCATGGTTATCGACGGGAACTTAGTTGCATTTGTTTTGGTTACCGACAAGGGAACGACG
GACATTAGTCTCCGAGATGTCTGTCGTCGGCTGTTGCCTCGCTTTATGATCCCCGGAGAATTCCTGCTCGTCGAC
CAATTCCCCCAACTTCCCTCGGGCAAGATCGATCGTAAAACACTAGAAGCCAATTTCATTCGCCACCGAAGCACT
GCCCTGGCTTTTGATGATCAACCCTGCCGAGACGAAAAAGAGGAGTCTATCGCCTCAAGCGTAGCCGATGTGCTA
GGCCGACGACTCCCGTCGACAGAGAGCCTGGCAGCAGCAGGTCTTGATTCGCTAGCAGCAATCCGTCTCGCGTCT
CATCTCTTGGATGCAGGAATTCGGCTAGGTGTGGCTTCCTTGTTGGAGGCCGACTCAGTGGACGGAATCTGGCAA
CTTGCCACCAGTCTTGAAGCTATGAGCCCAAATAATGATACGCAAGCAGCCTTGCAAACCATTCTTCAGCTTGTT
TTAGACGCAGGTGCAGCAAGGGTCGACTCGCTGGGCTTGAGCGATCAGGTTTCGGACGTCATACCGTGTAGCCAT
ATCCAACAGGCTATGATCTTGGAGACTGTTCGAGATAACAAGGCATACTGCAACTGGATTGAGCTGGAATTCGAG
CCCTCGGTCAGTTCAACTGCGGTAAAGAATGCATTTGGTCAACTGGTGGACCACAACCAGATCTTACGGTCCGGA
TTTGTGGAAATCGGCCTCAAAGATCACTCATATGGTCGATTCACCTGGAATACTGTCAATGACCATATTTCCCTG
AAACATGAACTTGAATACGATTTGGGCCTGAGTGCGGGTCACGATGTCTTGAACCCTTTTCGAGTCCAGATCAAA
GAAGGCAAGGACCATCTCCGCGTGCTGGTGCATATCCATCATGCTCTTTATGATGGATGGTCTTGGCAAATTATG
TTGAAAGATCTCAGAAGTATCTTGTCCGGAGAGGAGCTCACTTCCAAACCGCCATATAACATCGTCGCAAACTAT
TTCATTGAGCACAAACTGGACAAATCGGCAATAGAGTCCTCAGTGTACTGGCGTGAACAACTCCAAGGTCTTTAT
CCTGCAACTTTCCCTATTTTCCACGGACATACAGATATAATACATGCTACCGACAAGGCTACTCGCGTGCTGGAC
ATATCCGTATCAAAACTCAACCAAGTTTCCCAGCATCTTCGCGTGAGCCGGCAAACCATTTTTCAAGCCGCGTTT
TGCTATATTCTCTCTTCCTACATTGGAACCGGTGATATCACATTTGGAACTGTCTTTTCAGGCCGAACTCTGCCC
TTGAAGGGCATTGAAACGGTTCTCGGGCCTTGTATCAGAACTTTGCCTACGCGCATGAACCTCGACAAAATGCAG
GACGTGACCGATCTTCTTTTGGCCATCCAGAATATGAACCGCAAGTCACTCGAGCATGGCAGTCTTTCTCTTCAG
GATATCAAGAAGGCTTCTGGTATCGACTTGGATCGCAGTCTCTTCGACACAGCGCTCGTGTGGCAGGAAAGCATT
TGGTCAGATGATGACCAGGGCTCGGTGTTCCGGGAAGTTGGAGCGGGGGAGTTTTTAGAATTTGCGCTGTTGCTG
GAGTTTGAGCCGCGAGAAGAAAACATCTTTGCTCGGGCGACATATCAAGAGTCGGTGCTACCAGTTGAGCAAGCT
ATGATACTACTCGAGCAGATTGATTCTGTGGCCTCGGTCTTGATTGACAAGATTAAGCTTCCAATCCAGGAGATT
CGATCGTATCTTCCCTCGTCAACGCTGTCAATTGAACATGCAACATTACGCGATCAAGTCAATTTGCCAAGCCTG
GCATCTAGCGTCGAGATGATTGCTTCTACAGACCCGGACCGGGTAGCGGTTGAGTTGATGCTCTGGAAGTCAGAG
AATTCTACTTCGTTGATGGAAAGCATGACCTATAGTCAACTAAACTCCCGAGCCAATGGCTTTGCACACTTCTTG
CTCCATATCGGAGTGACAAATGACGATCTAATAGCCATTCATCTGACAACGTCTCTTGACTTTTATGTTGCTGTG
CTTGGAGTCGCCAAGGCCGGTGCTGGTCTCCTCCTCCTTCCCCAGGCTTCTTCGCAGAAAATCCATTCTATTCTC
TCCACGGCGAAATCCAAGTTCTGTATCATCGACCACTTGACGGAAAGAGATCATAGCTTGGATTCTCTGAAGTCC
GTCCAGCTGATTCATCTCTTTTATTCACTGGATGTTTACCATGAGTTTAATATTCCATATACCAGTAAAGGGTCT
GACGTTGCCTATGCTGAAGTGTCGCTAATTGAAGATGACTTGATTGAAAACATCGTCATCTCACGGCAAAACCTG
CAGAGCAATATCAATGCTCTGTCAGACTCGTATCCAGCGCCAACCGGATCGAAAATGCTATCATGTCTTCAGGGA
TCAGGTGGTAAGTTTTCCATGACATTTTAATTTTCAGATTATCTTTCTGACAAGAATACAGCATCTATTTGCCAG
GCATTCTTTGCTTGGCATGCTGGCATGACATTGTGCTCAGCTACAGAATTGATAATGATGACTCGTATCGAGCAA
GCCTGTCAAGACATGAACATAACACACCTGCACTTGCCTCCCATGCTGGCCTCCCGTATTGATCCACAAGCCGTC
CCCAGTGTGCAATATCTCCTCTCTTCTGGTGAAGAAATGACCCTTAAGCTCCATCACAATTGGGCCGGCAAAGGT
CTGAATCAAGCATACAGCAACCATGCACTGACTCACGCATGTACTCTCTGTCTTAATATGCAGGCATCGACCCAT
GTTCGAAACATTGGTAGACCCCTGAAGAACACATCTGCCATGATTGTAGCAGATGGAGATTCGCTCAGCCTTCTT
CCACGCGGTGCCATTGGAGAGCTATGCTTCGGCGGGGATCAAATTGGGCGCTGTCTACCTGACTCCAAGTCGCCA
GTTACTGGGCGATTCGTTGATCATCCTGAGTTTGGTCTGATCTATAGAACGGGTGACTCTGGAAGGCTGCTTCCT
GATGGTACACTCATTCTTTCCCGAAGCTCTGGCCTTGCTCAGTCGTATGCTCCGTCTATTGATCTAGACGGAGTT
GATCGTGCTCTGATGTCTTTAGAAATGGCAAAAGAAACAGTGAGCATGATTTTGGATGAGCCGACACTGCGATTG
GCAGTGTTCTGGGTTCCTTCAAAGAAATGCTCAGGTTCCGTGCAAATCGAGAAGGCTACGAATGATCTTTTCAAG
GAGCTCACCAAGAAACTTTCTTCTTCTGACCTTCCATCCCTTCTTGTTCTCGTTGACACGATAGATCTCACTAGG
TCTTATAAGATTGATTACTTCAAGCTGAGGCAACGGTTGGGGCAACTGATAACGAAGGAGCTTGCGATATTTTCA
CCAAAGCCTAATACCGATACTAGTGACAGTTTCACTGATCTTGAGAAGACTATCTCTGCCGCGCTATCGGCAGTC
ACTGGCACCGACCAAACAAACGTCCGCAAACACACATCTTTCTACAGACTGGGTCTGGACTCTCTTTCTGCCATT
TCCTTCTCGCGAAAGCTGCAGGAGTCTGGATGTGGAAGGCTTGCCGTGTCCACAATCCTGCGCCATAGCTCTATT
TCTCAACTTGCAGCTGTCATTACTGCCACGACCAACGGGGATCAGCCCGAAAATGCGGTGCCCGCACCACCAACA
GTGTTCGATGAAATCTTCACTCATCAAATAGAAGATGAGTTCAAAGCTACAGCCATAAATGTTCAAAGCATTTAC
CCTTGCACTCCACTCCAGGAGGCTATGCTTGCAGCTGAATCTGGTGATCATTCGGCTTATTTCAATCACCTCTTG
CTTCTTGTGCATACCAATGCCGAGACCATGAGAGCAGCATGGGCTAAGATGATGCAAAGACAAGGCATTCTTAGA
ACTTGTTTCACGCAAACTAATGATAGGCGGTTCGCATATGCTCAGGTTGTACTGGACACATCGGTCTTACCGTGG
TCCCATATTGAAACTTCCTCTTCTGAGCTTGAGAATGTCATCAAGGAAAACAAGTCCAAGTTCGAGGGTATTTCT
CCTGTCAACGGCCAGTTGCCTTACTCATTGACTTTGATAACCGATTCAACTGCGCAGCAGACATATCTTCTACTG
TCCATCCATCATGCACTGTATGACGGAGAAGGTATCGCCCAGTTATTGCAAGAGCTCCAGCTGTTGATTTCAAGT
CAAAAGTTGCCAAAGAACACTCCATTCCGCAACTTCATCGATTACATGACCTCTGTTGATTATGGCTCGTCGGAT
GAATACTGGGACCAGTACCTGTCCGGTGTTTCACCGACCCTCCTTCCCACACCCGGGCCCGCAGCCAATGCAAAT
GAGTCGGCATCACAGCAGATCCATACATCCCTCAATGGCTCTTTCGTATCATTCAGGCAAAACTGCAAAGACCTC
TCCGTGACCCCTTTGAACATCTTCCATGCTGCATGGGCCAGACTCCTCTCTCTATACACCGGTTCATCCGACGTC
TGCTTTGGCAATGTCTTCAGCTGCCGAACCGTTCCCTTGGATGGCGCAGATCGGATAGTCGGGCCTTGTTTCAAC
ACACTCCCAATTCGAATCAAGTCTTCTTCAACTTCAACAAATAGTGACATCATGAAATTGTCCCAAAAGAGCAAT
AACGACATTTTGCCTCACCAACTCAGCCCTCTCCGGCGTATTCAACGACGTATTCTTGGCGATGGCTCTCGCCTT
TTCGAGACGCTCGTCATTTTCCAGAACAGAAATACAGATCTCGATTCCAATATCTGGGAACTTCTTCAGGACGAA
GGAAACATGGGATTCCCCTTGATATGTGAGATCATCCGCGACGAGTCTAAAGACAAAATACAGATCTGCCTCCAC
TTCCAAGTATCGTATATCTCACAAGCCGTGGCTGAGAAAATTGCGCGGGACTTTATAGTCCTTGTTGGACACATC
ATTCAATATCCGTCTGCTCAGGCATCCGATAAGCGGCTATTAGGGGCAGACATTCCTCGAGTATTTGAACATAAC
GTGTCTAAGACGTCAAAATCTGTTCAGTTCCCCACAAAATCTCGCCAAAAGCTCCCATGGTCCTATCGAGAGGAG
ATTGTTCGCGACCTTCTTTGCAAATTTTCGGATGTCGACTCGGATAATGTGTTCCAGGACACAACGATCTTCCAA
CTTGGCCTGGATAGTATCAACGCTGTTCAGGTATCGGCGAAGTTGCGTGAGTTAGGGTATAAGATCTCATCTGGT
GATATTCTCGAGGTATGTCATATTCCTGGGGGTGAATTCTATTCTCTACCTACTGACTTGTATCAGGCTGCTTCT
ATTGATCAAATCGCTTCCCTTCTTACTTCCAACGCGAAGATTGTTGAGGAAATCGAGTTCGACTTTGGACTTTTC
CAAACCAATTATTTGCAGTCTGTTTGCCAGCAACTTGAGATTTCTTCGCAAATAGTGCAGTCTCTGCGCCCTTGT
ACGCCAGTCCAAAACGGAATGCTGGCAATTTTTACACATTCACACGGTGAAGTGTACTTCAATAGAATGACCTTA
AGGTCCTCAGTACCTTTAGATAAGAAGGTCTTGAAAGAAGCATGGTCTAAGGTCATGGCTCAGCATGAGATGCTT
CGAACAGGATTTGTTGAATTGCGCGATCAGAATAATCCTTTTGCTATGATAACTTACCATGAATACGGCAAATTA
CCATGGTACGAGACCTCGTCTTCCATGGAAGTCACTTCTGGTGTTCAACAAAGGCACGCTTTGGAAAATCTCCAC
CAGCCTCCATGGAGCATTGAAGTCGAAGTAGGTGACCACACCAGTATCATGCATTTCTCTGCATTGCATGCTATT
TATGATGCTCAGTCTCTGGCCACCATACTTTCAGACGTCAGAGCAGCATATGAAGGAAAGGCTCTGGCTATGCCG
GCCCCAGTCACCAAAACTCTCGGCCCTATCCTTCTTGAGAGTAAGAGCCAGAGCGAATCAGCGCAATCCTTCTGG
AAGGGACTTGCCCCAGAAGTGCAGCCCTCCAAATTCCCCGACTTAAATCCCATCCGCACAAACGAGCGAACATTA
CTCACCACCTCCATCCGTTGCATACAGTCTCGCAAGGCTTTTGAAGATGCCTGTCGAGATATCGGCGTGACACTA
CAAGCAGCGGGGCAAGCCACGTGGGCTCGCTTGCTCTCTGCGTACACGGGCGAGTCCAACGTCACTTTTGGAACC
GTGCTTTCAGGTAGAAACTTGTCCGCTGATGCTCAGCATGCGGTATTCCCGTGTTTGGTCACAGTGCCGACGCCC
CTGCATATTGAGGGTTCCAACCGACAGCTTTTGGACTGTACGTTGAAGCGAAATGCTTTATTGGTAAAGAATCAG
TTCGCGCCTCTGTCGCATATCCAGCGTTGGCTAGGTAGCGATGAGCCACTCTTCGACACGCTGTTTGTCTATCAG
AAGTTTAATTCTGATGCCGTTGGTGCTGATAAGTGGGACATCATTGGCGAGGAGACGAATATTGATGTGAGTAAC
AAGCAGACAGGATACTCCACAAATTTACAGGATCTAGGCTAACATTATATAGTATCCTGTCTCTATCGAATTGAT
TCCGCACTGGAACGATCTTCAGATTTCGTTGAGCTACCGGGGCGATCTTGTACCCATGGAGCAAGCAAAGATCCT
CTTGAATCAGTATGAAAGATTATTGCAAGATACTGTCTTCTGTCCAGATGTCAATTCCACCGATTACGACTCTGT
GGGTAGTAGTCTGCTATCAATTACTCCTGCCAAAGAAGCACCAATTCCTACCACGGTTTCTTTGCTACATCAATT
CGTCGAGACGAACGCGATCAATATTCCCGAGAAGATTGCGTTTGAATTTGCTTTCGGTGACATTGCAGAAAATCT
GCAGAAGAAGACATGGACTTACCGTGAGTTCAATGAATGTGGCAATCAAATTGCGCATTTCCTGCAGGCCAAGGG
GGCTATTCCTGGTGGAATTGTGGGAATATGCTTCGACAAGTGCCCTGAAGCCTCCATGGCGATTCTGGGTATTAT
GAAAGCTGGATGTGCATATCTGGCTATTGACCCTGGTGCTCCTATCTCTCGTAAGCAGTTCATGTTAGAGGACTC
GGCTACCAAGATCCTCCTTTGCAATCAATCGAAGATGGCGGAACTAGATGGTCTTCCAGCTATTGATGTCCAGGC
ACTTGATGAGCCTGGGCTTCTTGACCGGGTTTCAACAGGGGATATCTCACTTTCCCGTCCTATCCAGCCAGATGA
TACTTGTTATTGTCTGTACACATCCGGTACAACTGGAACACCGAAGGGCTGCGAGATCACGCACGATAATGCCGT
GCAAGCAATGCTGGCATTCCAACGATTGTTCGCAGGACACTGGGATGAAGAGTCTCGGTGGTTGCAATTTGCCTC
CTTCCATTTTGACGTCAGTGTTTTGGAACAGTACTGGAGCTGGAGTGTTGGAATTTGCGTCACTTCCTGTCCACG
CGATTTGCTGTTTGAGGACCTGACTGGAACGATACAAAAGCTTCGAATTACGCATATTGACCTGACGCCCAGTTT
GGCAAGACTAGTCCATCCCGATGAAGTTCCGTCGCTTTGTCGGGGAGTCTTCATCACCGGCGGAGAGGCCCTGAA
ACAAGAAATCCTAGATGTCTGGGGCAAGCATGGTGTCATCTACAATGGATACGGTCCTACTGAAGTTACTATCGG
ATGCACCATGCTCCCACGGATGTCTGCCAATGACAAAGCCTCAAACATCGGGCCTCAATTCGATAATGTGGGGTC
ATATGTCTTCAGCCCCGGTACGACGACACCAGTCCTACGCGGCAGCATAGGCGAACTCTGCGTCTCGGGACCTCT
CGTTGGAAAGGGCTATCTGAATCGAGTGGAGCTCACCAAGGAAAGATTCCAAGAGCTTCCCGAATCTGGCGATCG
CATCTATCGCACTGGCGATCTTGTGAGAATTTTGCACGATGGAAGCTTCCAGTTCCTCGGTCGCATTGATGACCA
GGTCAAGCTCCGCGGACAGCGACTTGAGATTGGAGAAATCAACGAGGTCATCAAACAAGCTACGCCTGAATTGAA
CGAAGTCGCTACCCTGGTCATCACGCACCCCAAACAATCGAAGGATCAACTTGTCTCCTTTTTCACGACTGTCAC
TGCAGATAAGAAATCTCGTGCTGTCGACGTTGGAGTCCGATATTCAGAAGAGGACCGCGCCCTGCTATCGAAGAT
CAAGGGTGCTTGCCGCACTCATCTTCCTAGGTACATGGTGCCTACACATATCATCCCGATGACCCAATTTCCGCT
GTCTGCCAATAACAAGGCTGATATGAAAGTCTTGAAGAGTATCTATCAGGAGCTTTCGCTAGAAAACATTCAGAA
ATTGAGCTCGATGAGCGTTAGCCAGTCTACTGACAGTGTCCAGGAACAGAAGATCATATCTGTCCTGGCGAGGTT
TATTGGTTCCTCTGAGGAGAAGATCTCATCATGGTCCAGTATCTACGAGCTTGGTCTGGATTCTATATCTGTTAT
TGCTTTCTCGAGAAGTCTCCGGGAGGCTGGGTTTTCTCAGGCTCAGCCATCGACCATCATGAAGTGTAAGTCTGG
CAGTCTAGGTGTTGGTTAAGAATTACTTGACTAACGATACATAGACCCTACAATTTCCGGCATGACGTCGGCTCT
ACAGGTGCCTATCTCATCTTCTGTGTCCGTGGAAACCTTCCAACGCAATGCCAAGCAAGGCATCGAGGCTTTCGC
TCACAAAAACTCCCACGCTATCATCGAGCATATTGGAGCCCGCTACGGTGACATTGAAAAGATTGCGCCCTGCAC
CCCGCTTCAGGAGGGTATCATATACCACTACCTGGCTAGTAGCACGCCGTTGTACTGCTCATCTTTCACTTTCGA
GCTCGACCCTTCAGTGAACCTCGAGAATTTGCGCGCGGCTTGGGATCAGGCCCAGAGAGACGTTCAGATGTTGCG
CGCCAGATTTCTGCCATCTCCAGACGGCTATGCCCAAATTGTCATGAAGAAAGACGCCCTTCCTTGGTTCCTTGC
TACGGCCGGTACCAATCAAGAGATTGATGACTTGCGCAAAGAACGACATGACCACTGGATTGCCCAGCTCGACGG
TCTTTCATCCAATCTATGGGAAGTCGGAGTCATCTCTTCCCCCAAGATATCGGTAATGTGTTTGAACATCTTCCA
TGCTCTCTATGATGGAAACAGCCTAGTCCTGCTCCTCGAATTGGTTGCCCGAAGTTATCTCGGTCAGATCGAGAG
TTCGGAGTTAATCCCGGAATTCCTTGATGTGTTGCACTTGGGTCCCCTTTGTAAAAACCCTGCTGCAGAGGCGTT
CTGGAAAGTTCATCTTGCTGGCTGTCGTGATCGAGCTTTCGCCGAGGACGGCCAAGTAGACAGCGCGCCAATTCT
GCTTAAAGCTCAAATGAATGCGACAGATCAAGTTGACCATCTTCGCCGGTCTCTCAATGTTACAGAGCAAGCTGT
CCTTCATGCCTGTTGGCTTCTTACTCTCCAGCAACAATACTCCTTCGTGCCACCACTTGGTATCATTGCCTCAGG
CAGGACAATCGATGTACCAGGCATTGGCGACGTTATTGGACCGCTGTTCAATACGATCCCCAGCAATGTCCAGCT
GCATGGCTTGGAGTCTTGGTCTGATGTCGCTCGGCGCTGCCATGACTACCAGGTGTCCATGATTCCTTTCCAATA
CACCGCCTTGCGGGACATCGTGAAATGGCTCGGAAAGAACCCCGACGAGCGGCTCTTCAGCTCCTTGTTTGTCTT
CCAGAGGGAAGATGATAACGACGAATCGTTCACAAAAGATCTTTGGTGTACACTTGACTCGGAGGCCCAGCATGA
ATACCCTCTGGCCTTTGAGATTGTACGCAATAGCAAGCAATTTTTTACAGCCACTATTGCCGCAAAGAGTCATGC
GGTATCGTCGGAAGATGCTCAGCAGATGTTATCTAAGTTTGAGCAAATTCTTTTTGAGTTTGCGCAAGACCCCAA
AAGAGAGTTGCCCAAGATAAATGGGGTGTCTCTCGCACAAGTTGTGGCGGATGGTGAAGTGAAGGGACACCACGA
GTCTCCAAGAACCCCAGAACATACCAATGGTGAACATACCAATTTCGAACATATTAATGGCTCTTTGTTTGAATG
GACTTCCCAGGCTTGCATAATTCGCGACGTGATTGAAACCCTTGCGGGGGTGGAGCCGCAATCCATCAACGAGAA
CACATCAATCTTTGAAGTTGGACTTGATAGCATCGATGCCATCAAAATCTCCTCGCGGTTGAGCAAAGCCGGCAT
CAAACTTCCTGTGAGTTCCATCATGCGCCATCGTACAGTCAAGGCAATGAGCGAGCAACTCTCAATGACAAATGG
TCATACCAAGGATGGGACATTATCATCACTTAATCGGCTAGAGAAATTGTTGACCGAGTTCCTCGGGGCTGAAGG
TCTTCTCCCCCCGAGCGCGATTCGAGTCTTACCAGCCACACCCATCCAAGAAGCTATGGTCGCTGAAATGTGTGC
CTCTGGGTACAAGCATTATTACAACCACGAGATCCTCGAGCTTGAGCCAGATGTAGACATTGAAAAGATGGAGCG
GGCATGGAGAGCTGTCGTTAGAGCTCACCCTATCCTCCGTACTTCATTTGTTGAAGTCTGGGATCCGAAGATTCC
TGTTTCATACGCCCAAATAGTTCACAACGAGGATCAAATTGACCTCAAGACTATCCATCTACACGGCGTCTCCGT
GGAATCCGTTATAAAGACTCAGCGCTCAAGGGTCCACAATAAGCCGGCAGGCTGTCCCTTGCTCTCTATCACCAT
TGCAGTGGAAGGGGATAGGCGGTACCTTGTTTTGTCAATTTCGCATGCTCTCTATGATGGTTGGTCAATCAATCT
GCTCCACGAAGACGTTGCCAAATCGTATGCTGGTGTAGAGTGTTCTCGCCCGCCAGCCGATGAAATTCTCGGGCA
AATCATTGCCTCGTCTGGCGACGAAGCCCTCAGATTCTGGCGAGCAACGCTATCCAAATTCACCCCGGTGTCATT
CTCTCCTATGGAACATGCGGAGAATAGCTCGGTTGTCGTTCACCGAGCAGAACAATCATTATCCGTTCCAATGTC
CAAGGCGGAGATGTTCTGCAAACGTCATGGCATTACCCTCCAGGCGCTTCTTGTCGGCTGCTGGTCTCTTGTCCT
TGCTAGGCATGTCAAGAAGCTAGATGTGGTATTTGGGCTTGTCCTTTCCGGTCGGAATGTGGCTAACTCTGAGCA
CGTGATGTTCCCGACTATGAACACTGTCGCCATGCGAGTTATTCTTCATGGGACGCGGGTAGAATTGGTGAAATA
TGTGCAGGAGGCTCTCCTCGCCATGTCGGAGCATCAGCATTTCCCGCTTCGGCGCGCCAGACCAGATACGGGATC
GCGGGCATTGTTCGATACGCTTTTCATGTATCAGAAGAGACCGGTCGAAATTGTCCAGAATGAGCCTAGGCAAGT
CTTATATAAATCTACTGGCGGAGCAGCCGAAGTTGAATACCCTGTTTGCGCTGAAGTTGAAGGTGTCGGGGAGGA
TCTAGTTGGACGAGTTGCTTGTCGTGGAAATGTTACTGGGTATCAAGATACTCTTGTGCTGTTGGAGCAGATGAG
CGATATCCTTTCGTCTATCATCGATGGTCCATCTGAACAGACTGTGGATTTTACCAGTGAGGGAGTGAAGATTTG
TGGAAGCGCCGCTTTCCAGGATGAGTCTGAACAAAATATCGAGCCTGAAGCAGTGCCCGGGACACTCGATCAGGC
GGAATGGTCGCCGATTGAGTCAAAGATCCGCAAAATTCTTTCTATTGCATCCGGGGTACCTGATGATTCCATTGA
CAAGAGCTCCACCATCTTCGAGCTTGGCCTGGACAGTATCAGCGCCATCAAGGTGGCTGCACTCCTGAAGAAACA
GTCCGTCAAGCTTGCGGTCAGTGACATGCTTCGGGCTGGTACTGTTGAAAACATGGCCAAAGCAGCCAACAGCGG
CCTAACGGAGGTCTCGCTCACAAATATATCAAGCATTCTCCACGATTCACTCGATGGCATCGATGTGGCGGGACT
GCTACAGTCACATGGTATTGATTTGCAACTAGTACGAAAGGTGTTCCCCACAACTGCAGGGCAAACCTATTTCCT
CTCAATGCACATTCTGAATCCAGAGATATTCTATCCTGAGTTTTACTATCTGACATCACGACAATTGAGCCCTGA
AGTACTCGATCGGGCCTGGGCTCGGGTCATAGACCAAACCCCAATGCTTCGGACGGTATTCGTTCCCACTTCCGA
CTCTCCGCTATTACCCTATATGCAGATCGAGTTTGAGGTTGTGCACATTCCGGTGATCTGGCATTCCAAGTTTGA
TCGGCATCTTGTTTCAAGAAGCCCTAAGCAAGAATTTGGGGTAGTGCCGGTCGCACTGCATGCCTGTCAAACGAA
CCAGGGAACGGCGCTTATTCTGCAAATCCACCATGCATTGTACGACGCTGTCAGTTTACCCCATATACTGAACAG
ACTTGTTACGCACTGCGGCCAAGAGGATGTTGTCAAACCAAACCCCGACCTTGATCTCGCACAGCTCGTGGCATT
CCAATATGTTCATTCGCCCGTGGATGTCCGGCGGCAATTCTGGCAAAAGTATCTAGGCCAAATCTCAACGGCGGT
AAAACGAGGGCATTGCTTCGGCTCTGTGCAACATCACTACCGACCGGGCCTGGTTTCAAATATGGCCAGTGTCGA
AAAGGTTGCCAAGCGCCGGGGCCTTAGCATTCAGACCGTCTTTTTAGCCGTCTATGCACGAGTGCATTTGCAGCA
ATTCGGTGCAGCTGAAACCACAAATGGCGCAGGGTCTCGCAGGCGGTTAACTGTTGGACTGTACCTTGCCAATCG
ATCTCATTCCATTGAGGGTTTAGCCGAATCTGTTATTCCCACCGTTAACATTGTTCCACTACGACTGGATGACAA
ACTCAGCGATTCCAACGACACCCTCCTTGACGCCGCCCGCAGAATTCAGACTGAAATCAACGAGATCAGCCGACC
CGAATATTCGGGCGTTTCTCTCCTGGAAATTGCCGAATGGACGGGCATCCGAATCGACACCTGCGTCAATTTCCT
GCGACTCCCTGAGCAAGAATTGAAAGTACCCGGCAACTGTGACCACGCAAAGTTTTCTTTTACAGCAATTCAACG
CGAGGAGTTTGAAGATCTTAGCGGGGCAGCCCCGGTTTCGAAAAATGACCCAATTCCGATTAATGGCAATGGTGT
AGCGCCACCTGGTGCAGCCGAGACGATCCCAGGCCTCGAGCATCCAAGCGCCTCAACGGCGGCTACTCAAGACAT
CTTCCAGGTAAGTGGGGGAATGCACATCACTTTATCCTAACGGGTAATTGAGCCTTATACAATTGCTTACATTTC
AACAGTCTACGATCGACGTGGAAGCCGCCATCCGTAATGGTCGGTTAGACTTTGGGCTTTTCGCACCAGAATCTC
GTCTTGACCGAGATACAGCGGAAACTGTGATCGGCGCTATGCAACGGGAGATGTCGGCATTGGTGACAGGCTTCG
AATCGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail