Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4130.t1
Gene name
Locationscaffold_08:69837..72209
Strand+
Gene length (bp)2372
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 3.4E-35 440 575
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.0E-07 68 115
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-12 125 216
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.2E-10 157 244
PF13857 Ank_5 Ankyrin repeats (many copies) 1.0E-06 210 259
PF13606 Ank_3 Ankyrin repeat 3.3E-07 85 114
PF00023 Ank Ankyrin repeat 2.1E-06 86 115
PF00023 Ank Ankyrin repeat 2.0E-02 186 216
PF13637 Ank_4 Ankyrin repeats (many copies) 2.1E-06 88 140

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 310 332 22
2 353 375 22
3 390 412 22
4 489 511 22
5 540 562 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4130.t1
MSAKPSLESLGPSHGQTSGSTFASNGNGTAIPPNDVEMKSLRPDPPKGSIPLGEDIMQLARMGEVGTMQKLFTAK
KFTANYRDEEGITPLHWAAINNQYAMCKFLIDSGADVNAKGGESVATPAMWAAQRCHYYIVNLLLQNGGDPLLTD
VQGYNILHLATIDGNAFLVVLLLHQEIPVDVVDQQGHTGLMWAAYKGYPACVDLFLRWGANANAVDEGGLTPLHW
ALVKGSMPCVLKLLEYGTDRFAKTRDGKSPATVAQEMNTLRVWYHSLNERGFEPDGTQKVVPLGLSSFVRSKSIM
AKFFFLWPFLMILITIWMLSSLAIFIAVPLVLVTVFGMQYVAQQFANKGPMEYRVLQKTPYLAGVFAGTLFWVGF
RYVFKVLPATYSSSPILNILFAVFFCLTAYFYVFAMVEDPGYVPKVSSRNQQREVVKELFDQWKFDEENFCIPCM
TRKPLRSRHCRRCGRCVAKHDHHCPWIDNCVGSNNLRHFVLYIVSLEVGIILFVQLTIAYINSLPAPVNATCNVI
NDTLCDYATRDPFTLILNVWITLQLVWVTMLCAVQLVQISRNQTTYENMRGHHIDRSYPSTQAFASAMTAGTTSM
EAAGLSASGQGPNPALRGSPAHRRKNGCIQQWSSLLGVDAFWTTAKDGLRDGPQATRPRNPFSRGVVTNCRDFWC
DPAPLFGKRQTGVAMLGGEVINYHDMYETPMRMRTGNRSGEGPGYRSVAGEDPERMV*
Coding >Pro_DTO377G3_2|g4130.t1
ATGTCTGCCAAGCCCTCTTTAGAATCCCTTGGCCCCAGCCATGGCCAGACCTCCGGTTCCACTTTCGCCTCGAAT
GGCAACGGGACAGCTATTCCTCCAAACGACGTGGAGATGAAGAGCTTGCGCCCTGATCCCCCTAAGGGCTCAATT
CCTCTGGGGGAGGATATCATGCAGTTGGCTCGGATGGGGGAAGTTGGCACTATGCAGAAACTGTTCACAGCCAAA
AAGTTCACCGCAAACTACCGTGATGAGGAAGGAATTACACCGCTGCATTGGGCGGCAATCAACAATCAATATGCG
ATGTGTAAATTCCTGATCGACTCCGGAGCCGACGTCAACGCCAAAGGAGGAGAGTCGGTGGCAACACCAGCCATG
TGGGCCGCCCAACGGTGTCATTATTATATTGTGAACTTATTGCTCCAGAATGGAGGGGATCCTCTCCTGACGGAC
GTCCAAGGATATAACATCCTACACCTCGCGACCATCGACGGCAACGCGTTCCTAGTCGTGCTGCTTTTACACCAG
GAGATCCCCGTGGACGTTGTTGACCAACAAGGGCATACTGGACTGATGTGGGCTGCATATAAGGGGTATCCTGCA
TGTGTAGACTTGTTCCTGCGATGGGGCGCAAACGCAAACGCCGTGGACGAAGGTGGCTTGACGCCGCTCCATTGG
GCGCTGGTTAAGGGCTCGATGCCTTGTGTCCTGAAGTTGCTCGAATACGGCACCGACCGCTTTGCAAAGACCCGC
GATGGAAAATCACCTGCGACTGTGGCGCAGGAAATGAACACCCTGCGGGTTTGGTACCACTCGCTCAACGAGCGC
GGCTTTGAACCCGATGGCACCCAAAAAGTGGTGCCACTGGGCCTTTCCAGCTTCGTACGCAGCAAGAGCATCATG
GCCAAGTTCTTCTTCCTTTGGCCTTTTTTGATGATCCTGATTACCATTTGGATGCTCAGTAGCCTGGCGATTTTC
ATCGCTGTGCCCCTCGTGTTAGTTACTGTCTTCGGGATGCAGTATGTTGCACAGCAATTTGCGAACAAGGGGCCC
ATGGAATACCGCGTTCTTCAAAAAACACCGTATCTAGCTGGTGTCTTTGCTGGCACATTGTTCTGGGTTGGCTTC
CGCTATGTCTTCAAGGTGCTGCCGGCAACATACTCATCGTCGCCGATTCTGAACATCTTGTTCGCAGTCTTCTTC
TGCTTGACTGCTTATTTCTACGTTTTTGCCATGGTCGAGGACCCGGGCTATGTTCCGAAAGTGAGCAGCAGGAAT
CAGCAGAGAGAGGTTGTTAAGGAACTGTTCGACCAGTGGAAGTTCGACGAAGAGAATTTTTGCATTCCCTGTATG
ACAAGAAAGCCACTCCGGAGCAGGCACTGTCGGCGTTGTGGGCGCTGCGTTGCGAAACACGATCACCATTGCCCG
TGGATTGACAACTGTGTTGGATCGAACAATCTCCGCCATTTTGTTCTTTATATAGTCTCCCTCGAAGTTGGTATC
ATTCTGTTTGTGCAGCTGACTATTGCCTATATCAATTCCCTACCTGCTCCCGTCAATGCCACTTGCAATGTCATC
AACGACACATTGTGTGATTACGCCACTCGCGACCCCTTCACCCTGATTCTTAATGTATGGATCACCCTCCAGCTG
GTCTGGGTTACGATGCTTTGTGCCGTCCAGCTCGTCCAGATCTCTCGCAACCAGACAACCTACGAAAACATGCGA
GGCCACCACATCGACCGGTCCTACCCAAGCACCCAAGCCTTTGCGTCGGCCATGACCGCTGGAACCACATCAATG
GAGGCCGCTGGTCTTTCGGCTTCTGGACAAGGACCAAACCCGGCTCTCCGCGGTTCTCCCGCACACCGACGGAAA
AACGGCTGCATCCAGCAATGGTCATCCCTTCTCGGAGTCGACGCTTTTTGGACAACTGCGAAGGATGGTCTCCGC
GATGGACCCCAGGCAACTAGACCCCGCAACCCCTTCTCCCGCGGTGTCGTCACCAATTGTCGTGACTTTTGGTGT
GACCCGGCTCCGCTCTTCGGCAAGCGCCAGACTGGGGTGGCGATGCTCGGCGGCGAGGTGATCAACTATCATGAT
ATGTACGAAACCCCGATGCGCATGCGCACCGGCAACCGGTCCGGCGAGGGGCCTGGCTACCGCAGCGTTGCTGGC
GAGGACCCCGAACGCATGGTATAA
Transcript >Pro_DTO377G3_2|g4130.t1
ATGTCTGCCAAGCCCTCTTTAGAATCCCTTGGCCCCAGCCATGGCCAGACCTCCGGTTCCACTTTCGCCTCGAAT
GGCAACGGGACAGCTATTCCTCCAAACGACGTGGAGATGAAGAGCTTGCGCCCTGATCCCCCTAAGGGCTCAATT
CCTCTGGGGGAGGATATCATGCAGTTGGCTCGGATGGGGGAAGTTGGCACTATGCAGAAACTGTTCACAGCCAAA
AAGTTCACCGCAAACTACCGTGATGAGGAAGGAATTACACCGCTGCATTGGGCGGCAATCAACAATCAATATGCG
ATGTGTAAATTCCTGATCGACTCCGGAGCCGACGTCAACGCCAAAGGAGGAGAGTCGGTGGCAACACCAGCCATG
TGGGCCGCCCAACGGTGTCATTATTATATTGTGAACTTATTGCTCCAGAATGGAGGGGATCCTCTCCTGACGGAC
GTCCAAGGATATAACATCCTACACCTCGCGACCATCGACGGCAACGCGTTCCTAGTCGTGCTGCTTTTACACCAG
GAGATCCCCGTGGACGTTGTTGACCAACAAGGGCATACTGGACTGATGTGGGCTGCATATAAGGGGTATCCTGCA
TGTGTAGACTTGTTCCTGCGATGGGGCGCAAACGCAAACGCCGTGGACGAAGGTGGCTTGACGCCGCTCCATTGG
GCGCTGGTTAAGGGCTCGATGCCTTGTGTCCTGAAGTTGCTCGAATACGGCACCGACCGCTTTGCAAAGACCCGC
GATGGAAAATCACCTGCGACTGTGGCGCAGGAAATGAACACCCTGCGGGTTTGGTACCACTCGCTCAACGAGCGC
GGCTTTGAACCCGATGGCACCCAAAAAGTGGTGCCACTGGGCCTTTCCAGCTTCGTACGCAGCAAGAGCATCATG
GCCAAGTTCTTCTTCCTTTGGCCTTTTTTGATGATCCTGATTACCATTTGGATGCTCAGTAGCCTGGCGATTTTC
ATCGCTGTGCCCCTCGTGTTAGTTACTGTCTTCGGGATGCAGTATGTTGCACAGCAATTTGCGAACAAGGGGCCC
ATGGAATACCGCGTTCTTCAAAAAACACCGTATCTAGCTGGTGTCTTTGCTGGCACATTGTTCTGGGTTGGCTTC
CGCTATGTCTTCAAGGTGCTGCCGGCAACATACTCATCGTCGCCGATTCTGAACATCTTGTTCGCAGTCTTCTTC
TGCTTGACTGCTTATTTCTACGTTTTTGCCATGGTCGAGGACCCGGGCTATGTTCCGAAAGTGAGCAGCAGGAAT
CAGCAGAGAGAGGTTGTTAAGGAACTGTTCGACCAGTGGAAGTTCGACGAAGAGAATTTTTGCATTCCCTGTATG
ACAAGAAAGCCACTCCGGAGCAGGCACTGTCGGCGTTGTGGGCGCTGCGTTGCGAAACACGATCACCATTGCCCG
TGGATTGACAACTGTGTTGGATCGAACAATCTCCGCCATTTTGTTCTTTATATAGTCTCCCTCGAAGTTGGTATC
ATTCTGTTTGTGCAGCTGACTATTGCCTATATCAATTCCCTACCTGCTCCCGTCAATGCCACTTGCAATGTCATC
AACGACACATTGTGTGATTACGCCACTCGCGACCCCTTCACCCTGATTCTTAATGTATGGATCACCCTCCAGCTG
GTCTGGGTTACGATGCTTTGTGCCGTCCAGCTCGTCCAGATCTCTCGCAACCAGACAACCTACGAAAACATGCGA
GGCCACCACATCGACCGGTCCTACCCAAGCACCCAAGCCTTTGCGTCGGCCATGACCGCTGGAACCACATCAATG
GAGGCCGCTGGTCTTTCGGCTTCTGGACAAGGACCAAACCCGGCTCTCCGCGGTTCTCCCGCACACCGACGGAAA
AACGGCTGCATCCAGCAATGGTCATCCCTTCTCGGAGTCGACGCTTTTTGGACAACTGCGAAGGATGGTCTCCGC
GATGGACCCCAGGCAACTAGACCCCGCAACCCCTTCTCCCGCGGTGTCGTCACCAATTGTCGTGACTTTTGGTGT
GACCCGGCTCCGCTCTTCGGCAAGCGCCAGACTGGGGTGGCGATGCTCGGCGGCGAGGTGATCAACTATCATGAT
ATGTACGAAACCCCGATGCGCATGCGCACCGGCAACCGGTCCGGCGAGGGGCCTGGCTACCGCAGCGTTGCTGGC
GAGGACCCCGAACGCATGGTATAA
Gene >Pro_DTO377G3_2|g4130.t1
ATGTCTGCCAAGCCCTCTTTAGAATCCCTTGGCCCCAGCCATGGCCAGACCTCCGGTTCCACTTTCGCCTCGAAT
GGCAACGGGACAGCTATTCCTCCAAACGACGTGGAGATGAAGAGCTTGCGCCCTGATCCCCCTAAGGGCTCAATT
CCTCTGGGGGAGGATATCATGCAGTTGGCTCGGATGGGGGAAGTTGGCACTATGCAGAAACTGTTCACAGCCAAA
AAGTTCACCGCAAACTACCGTGATGAGGAAGGAATTACACCGCTGCATGTTTGTTACAATCTAGCGCAACAAACA
ATAGGGATCTGTTTACTGACCGCATTCTCTCTTTCTAGTGGGCGGCAATCAACAATCAATATGCGATGTGTAAAT
TCCTGATCGACTCCGGAGCCGACGTCAACGCCAAAGGAGGAGAGTCGGTGGCAACACCAGCCATGTGGGCCGCCC
AACGGTGTCATTATTATATTGTGAACTTATTGCTCCAGAATGGAGGGGATCCTCTCCTGACGGACGTCCAAGGAT
ATAACATCCTACACCTCGCGACCATCGACGGCAACGCGTTCCTAGTCGTGCTGCTTTTACACCAGGAGATCCCCG
TGGACGTTGTTGACCAACAAGGGCATACTGGACTGATGTGGGCTGCATATAAGGGGTATCCTGCATGTGTAGACT
TGTTCCTGCGATGGGGCGCAAACGCAAACGCCGTGGACGAAGGTGGCTTGACGCCGCTCCATTGGGCGCTGGTTA
AGGGCTCGATGCCTTGTGTCCTGAAGTTGCTCGAATACGGCACCGACCGCTTTGCAAAGACCCGCGATGGAAAAT
CACCTGCGACTGTGGCGCAGGAAATGAACACCCTGCGGGTTTGGTACCACTCGCTCAACGAGCGCGGCTTTGAAC
CCGATGGCACCCAAAAAGTGGTGCCACTGGGCCTTTCCAGCTTCGTACGCAGCAAGAGCATCATGGCCAAGTTCT
TCTTCCTTTGGCCTTTTTTGATGATCCTGATTACCATTTGGATGCTCAGTAGCCTGGCGATTTTCATCGCTGTGC
CCCTCGTGTTAGTTACTGTCTTCGGGATGCAGTATGTTGCACAGCAATTTGCGAACAAGGGGCCCATGGAATACC
GCGTTCTTCAAAAAACACCGTATCTAGCTGGTGTCTTTGCTGGCACATTGTTCTGGGTTGGCTTCCGCTATGTCT
TCAAGGTGCTGCCGGCAACATACTCATCGTCGCCGATTCTGAACATCTTGTTCGCAGTCTTCTTCTGCTTGACTG
CTTATTTCTACGTTTTTGCCATGGTCGAGGACCCGGGCTATGTTCCGAAAGTGAGCAGCAGGAATCAGCAGAGAG
AGGTTGTTAAGGAACTGTTCGACCAGTGGAAGTTCGACGAAGAGAATTTTTGCATTCCCTGTATGACAAGAAAGC
CACTCCGGAGCAGGCACTGTCGGCGTTGTGGGCGCTGCGTTGCGAAACACGATCAGTATGTGTCTCGATAAGTTT
CTATTGATCTGACTACTAATGCTTGAATAGCCATTGCCCGTGGATTGACAACTGTGTTGGATCGAACAATCTCCG
CCATTTTGTTCTTTATATAGTCTCCCTCGAAGTTGGTATCATTCTGTTTGTGCAGCTGACTATTGCCTGTGAGTA
CTAGTGGCGAAAGAAAATATTGGCTAGGATCAGTCATCTAACATGATGCAGATATCAATTCCCTACCTGCTCCCG
TCAATGCCACTTGCAATGTCATCAACGACACATTGTGTGATTACGCCACTCGCGACCCCTTCACCCTGATTCTTA
ATGTATGGATCACCCTCCAGCTGGTCTGGGTTACGATGCTTTGTGCCGTCCAGCTCGTCCAGATCTCTCGCAACC
AGACAACCTACGAAAACATGCGAGGCCACCACATCGACCGGTCCTACCCAAGCACCCAAGCCTTTGCGTCGGCCA
TGACCGCTGGAACCACATCAATGGAGGCCGCTGGTCTTTCGGCTTCTGGACAAGGACCAAACCCGGCTCTCCGCG
GTTCTCCCGCACACCGACGGAAAAACGGCTGCATCCAGCAATGGTCATCCCTTCTCGGAGTCGACGCTTTTTGGA
CAACTGCGAAGGATGGTCTCCGCGATGGACCCCAGGCAACTAGACCCCGCAACCCCTTCTCCCGCGGTGTCGTCA
CCAATTGTCGTGACTTTTGGTGTGACCCGGCTCCGCTCTTCGGCAAGCGCCAGACTGGGGTGGCGATGCTCGGCG
GCGAGGTGATCAACTATCATGATATGTACGAAACCCCGATGCGCATGCGCACCGGCAACCGGTCCGGCGAGGGGC
CTGGCTACCGCAGCGTTGCTGGCGAGGACCCCGAACGCATGGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail