Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g413.t1
Gene name
Locationscaffold_01:1048674..1052265
Strand+
Gene length (bp)3591
Transcript length (bp)3240
Coding sequence length (bp)3240
Protein length (aa) 1080

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 4.3E-59 18 345
PF00679 EFG_C Elongation factor G C-terminus 2.5E-14 945 1025
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 2.7E-07 530 606
PF14492 EFG_III Elongation Factor G, domain III 3.1E-06 623 687

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032561 guanyl ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.08 9.96 24.21
5d_25C Five days - 25 degrees Celsius 17.53 10.27 24.79
7d_25C Seven days - 25 degrees Celsius 19.68 11.65 27.71
10d_25C Ten days - 25 degrees Celsius 19.25 11.36 27.13
7d_15C Seven days - 15 degrees Celsius 18.13 10.55 25.72
7d_30C Seven days - 30 degrees Celsius 20.05 11.84 28.26

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.941234 no
3d_25C 7d_25C 0.622896 no
3d_25C 7d_15C 0.862985 no
3d_25C 7d_30C 0.571577 no
3d_25C 10d_25C 0.691342 no
5d_25C 7d_25C 0.698377 no
5d_25C 7d_15C 0.926795 no
5d_25C 7d_30C 0.645238 no
5d_25C 10d_25C 0.767896 no
7d_25C 7d_15C 0.797379 no
7d_25C 7d_30C 0.960319 no
7d_25C 10d_25C 0.953639 no
7d_15C 7d_30C 0.748044 no
7d_15C 10d_25C 0.863417 no
7d_30C 10d_25C 0.910094 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g413.t1
MPVVNVDQLVRLQRKPEDIRNICILAHVDHGKTSLTDSLIATNGIISPKLAGKIRYLDSRPDEQLRGITMESSAI
SLFFSMLRRPSPDAEPVTKEYLINLIDSPGHIDFSSEVSTASRLCDGAVVLVDAVEGVCSQTVTVLRQTWVEQLK
PILVINKMDRLVTELKMSPAEAFSHLSRLLEQVNAVIGSFYQGERMEEDLQWRERMEDRVNAAAARDQDNKKTSA
DDESAQSITEGTEFEERDDEDLYFAPEKNNVIFCSAVDGWAFTIRQFAAIYEKKLGIKRTVLEKVLWGDYYLDPK
TKRVLGVKHLRGRALKPMFVQLVLDSIWAAYQATTGGDKGKGDPVLLEKITKSLNINIPVYVLRGRDPRNIMNTL
FSQWLPLSTALLVSVIEYLPSPPVAQAARLPEMIKKSPGAAFIADDIKTAMVEFKTGPEQPVVAYVSKMVAIPES
ELLSNRKRSEGAMTADEARQIARRKREEIAKMQAEARSNGEADDFDRMTSIFETTSLITETTEEPEEPVDKEDPD
HLIGFARLFSGTLSVGDEIYVLPPKFSPANPHASPEPKKVIVTDLYLMMGRALEPLKSVPAGVVFGIGGLAGHVL
KTGTLCSRLDGGINLAGVSLSMPPIVRVALEPVNPADLSKLVTGLRLLEQSDPCAQYEVLPSGEHVILTAGELHL
ERCVTDLRERFARCEIQTGEAIVPYRETIVHGPEMAAPKNPDLGRGAVVTVSASKQMTLRLRVVPMPDAVTEFLT
KQVGTIKQLQLEKRSEAEGKIETENAAEAAVDGTGEAPEGNILSKQEFREGLEKLFNDEVKEDKELWKNVVDRIT
AFGPRRVGPNILVDATAVNTCEKFLVDDTKQQIDGDNHQALVVRDFNDKIAYAFQLATGQGPLCQEPMQGVAVFL
EDLSVQSSAGDELDMGRLTGESIRLVREGISAGFLDWSPRIMLAMYSCEIQATTEVLGRVYAVITRRRGRILSEI
MKEGTPFFTILALLPVAESFGFAEEIRKRTSGAAQPQLIFAGFEALDEDPFWVPATEEELEDLGELADKQNVAKR
YMDAVRNRKGLVVQGRKLIDAEKQKTLKK*
Coding >Pro_DTO377G3_2|g413.t1
ATGCCTGTTGTAAATGTCGACCAGCTGGTCCGCCTACAGCGGAAGCCCGAGGACATAAGAAATATCTGCATTTTG
GCCCACGTTGATCATGGCAAGACATCTTTGACGGATAGTCTTATTGCCACAAATGGCATCATTTCACCCAAGCTG
GCCGGTAAAATCCGCTACCTAGACTCTCGCCCAGATGAGCAGCTTCGAGGTATTACAATGGAGTCATCAGCTATC
TCACTGTTCTTCTCGATGCTCCGCCGTCCAAGCCCGGACGCAGAGCCAGTGACCAAAGAGTATCTGATCAATCTG
ATCGATTCACCTGGTCATATCGATTTCAGCAGCGAGGTCTCCACCGCATCTCGTCTTTGTGACGGTGCAGTTGTG
CTCGTTGACGCAGTTGAAGGTGTTTGCAGTCAAACCGTGACAGTTTTGCGACAGACCTGGGTTGAGCAGTTAAAA
CCGATCTTAGTCATTAACAAGATGGACCGCTTGGTAACAGAGCTGAAGATGAGCCCGGCCGAGGCTTTCTCGCAT
CTTAGTCGACTGTTGGAACAGGTTAATGCTGTCATCGGTAGTTTCTACCAGGGCGAGCGCATGGAAGAAGATCTG
CAGTGGCGTGAGCGTATGGAAGATCGTGTCAATGCTGCAGCGGCTCGGGACCAAGACAACAAAAAGACATCAGCT
GACGATGAGTCTGCACAAAGCATCACTGAGGGAACTGAATTTGAGGAGCGCGACGACGAGGATCTTTATTTCGCA
CCTGAGAAAAATAACGTCATCTTCTGCAGTGCCGTTGATGGCTGGGCTTTCACAATCCGGCAATTCGCCGCCATT
TACGAGAAGAAACTCGGAATCAAACGAACAGTTCTGGAGAAAGTCCTTTGGGGTGATTATTATTTAGACCCTAAA
ACTAAACGCGTCTTGGGTGTGAAGCATCTGAGAGGACGTGCTTTAAAGCCTATGTTCGTTCAATTGGTCTTGGAT
AGCATTTGGGCCGCTTATCAAGCCACCACAGGTGGTGACAAGGGCAAAGGTGACCCAGTGTTGCTGGAGAAGATT
ACCAAATCGCTCAACATTAACATCCCGGTATATGTCTTGCGCGGACGCGACCCTAGGAACATTATGAATACACTA
TTCTCTCAGTGGCTGCCACTATCTACTGCCTTGCTGGTTTCCGTCATTGAATATCTCCCCAGTCCGCCCGTTGCG
CAAGCTGCCCGACTACCTGAAATGATCAAAAAGTCCCCTGGCGCTGCTTTCATTGCCGACGATATCAAGACCGCC
ATGGTGGAATTCAAGACAGGACCTGAACAGCCCGTCGTGGCATACGTCAGCAAGATGGTTGCCATCCCGGAGAGC
GAGCTTCTGTCTAATAGAAAGCGTAGCGAAGGCGCCATGACTGCAGACGAAGCTCGGCAAATTGCGCGTCGCAAG
CGGGAGGAGATTGCAAAGATGCAGGCGGAAGCCCGCAGTAATGGAGAAGCAGATGACTTTGATCGTATGACATCG
ATTTTTGAAACCACCTCATTGATCACTGAGACGACTGAGGAGCCAGAAGAGCCAGTGGATAAGGAGGACCCTGAT
CATCTTATTGGTTTCGCCCGACTTTTCTCCGGAACGCTTTCGGTTGGAGATGAGATCTATGTCCTCCCGCCCAAG
TTCTCTCCAGCCAATCCGCACGCCAGCCCGGAGCCAAAGAAAGTCATAGTCACAGACCTGTACCTGATGATGGGC
AGAGCCCTCGAGCCCCTCAAATCCGTACCAGCCGGTGTGGTATTCGGAATTGGAGGTCTTGCAGGCCATGTGTTG
AAGACAGGCACCCTCTGCAGCCGACTTGATGGAGGTATCAACTTGGCCGGTGTTTCGCTGAGCATGCCGCCCATT
GTCCGAGTCGCGCTAGAACCGGTCAACCCAGCAGATCTAAGCAAACTAGTCACCGGCTTGCGCTTGCTTGAACAG
AGTGATCCATGTGCGCAGTACGAAGTGCTGCCGAGTGGTGAACACGTTATCCTCACAGCAGGTGAACTGCACTTG
GAGCGTTGTGTGACGGATCTGCGCGAGCGTTTCGCCCGTTGCGAGATCCAGACTGGTGAGGCCATCGTCCCCTAC
CGTGAAACTATTGTTCACGGCCCCGAGATGGCTGCACCCAAGAACCCCGACCTAGGACGTGGAGCCGTTGTGACG
GTCTCTGCTTCGAAGCAAATGACCCTTCGTCTGCGCGTGGTTCCGATGCCAGATGCTGTCACGGAATTCCTGACT
AAACAGGTCGGAACTATCAAGCAACTCCAATTGGAGAAGCGCTCAGAAGCTGAAGGCAAGATAGAGACCGAGAAC
GCAGCCGAAGCTGCCGTTGACGGTACTGGCGAGGCGCCTGAAGGCAACATTCTCTCCAAGCAGGAGTTCCGCGAA
GGTCTAGAGAAGTTGTTCAACGACGAGGTCAAGGAAGACAAGGAGCTATGGAAGAACGTCGTCGACCGAATTACC
GCTTTCGGGCCCCGCAGAGTCGGGCCCAACATTCTAGTTGATGCAACTGCAGTCAACACATGCGAAAAATTCTTG
GTCGATGACACCAAGCAACAGATCGACGGTGATAACCACCAGGCACTGGTCGTGCGCGATTTCAACGACAAGATC
GCGTATGCCTTCCAGCTCGCAACAGGCCAAGGTCCCTTGTGCCAGGAGCCTATGCAAGGCGTGGCCGTGTTCTTG
GAAGACTTATCTGTGCAGTCTAGCGCAGGTGACGAGCTTGACATGGGCCGGTTGACAGGCGAGTCAATCAGACTG
GTACGTGAAGGTATCTCGGCCGGTTTCCTGGACTGGAGTCCTCGTATCATGCTCGCAATGTACAGTTGCGAGATC
CAAGCGACCACCGAAGTCCTAGGCCGCGTCTACGCCGTAATCACGCGCCGCCGAGGCCGCATTCTCTCCGAAATA
ATGAAAGAAGGCACGCCATTCTTCACGATCCTGGCGCTTCTACCCGTAGCCGAGTCGTTCGGGTTCGCCGAGGAG
ATCCGAAAGAGGACGTCCGGTGCTGCGCAACCGCAACTGATCTTCGCAGGCTTCGAGGCTCTCGACGAGGATCCT
TTCTGGGTTCCTGCTACAGAGGAAGAACTTGAAGATCTGGGTGAGCTTGCGGATAAACAGAACGTTGCTAAGCGG
TATATGGATGCTGTGCGCAATCGCAAGGGTTTGGTTGTTCAGGGACGCAAGTTGATTGATGCAGAGAAGCAGAAG
ACTCTGAAGAAATAA
Transcript >Pro_DTO377G3_2|g413.t1
ATGCCTGTTGTAAATGTCGACCAGCTGGTCCGCCTACAGCGGAAGCCCGAGGACATAAGAAATATCTGCATTTTG
GCCCACGTTGATCATGGCAAGACATCTTTGACGGATAGTCTTATTGCCACAAATGGCATCATTTCACCCAAGCTG
GCCGGTAAAATCCGCTACCTAGACTCTCGCCCAGATGAGCAGCTTCGAGGTATTACAATGGAGTCATCAGCTATC
TCACTGTTCTTCTCGATGCTCCGCCGTCCAAGCCCGGACGCAGAGCCAGTGACCAAAGAGTATCTGATCAATCTG
ATCGATTCACCTGGTCATATCGATTTCAGCAGCGAGGTCTCCACCGCATCTCGTCTTTGTGACGGTGCAGTTGTG
CTCGTTGACGCAGTTGAAGGTGTTTGCAGTCAAACCGTGACAGTTTTGCGACAGACCTGGGTTGAGCAGTTAAAA
CCGATCTTAGTCATTAACAAGATGGACCGCTTGGTAACAGAGCTGAAGATGAGCCCGGCCGAGGCTTTCTCGCAT
CTTAGTCGACTGTTGGAACAGGTTAATGCTGTCATCGGTAGTTTCTACCAGGGCGAGCGCATGGAAGAAGATCTG
CAGTGGCGTGAGCGTATGGAAGATCGTGTCAATGCTGCAGCGGCTCGGGACCAAGACAACAAAAAGACATCAGCT
GACGATGAGTCTGCACAAAGCATCACTGAGGGAACTGAATTTGAGGAGCGCGACGACGAGGATCTTTATTTCGCA
CCTGAGAAAAATAACGTCATCTTCTGCAGTGCCGTTGATGGCTGGGCTTTCACAATCCGGCAATTCGCCGCCATT
TACGAGAAGAAACTCGGAATCAAACGAACAGTTCTGGAGAAAGTCCTTTGGGGTGATTATTATTTAGACCCTAAA
ACTAAACGCGTCTTGGGTGTGAAGCATCTGAGAGGACGTGCTTTAAAGCCTATGTTCGTTCAATTGGTCTTGGAT
AGCATTTGGGCCGCTTATCAAGCCACCACAGGTGGTGACAAGGGCAAAGGTGACCCAGTGTTGCTGGAGAAGATT
ACCAAATCGCTCAACATTAACATCCCGGTATATGTCTTGCGCGGACGCGACCCTAGGAACATTATGAATACACTA
TTCTCTCAGTGGCTGCCACTATCTACTGCCTTGCTGGTTTCCGTCATTGAATATCTCCCCAGTCCGCCCGTTGCG
CAAGCTGCCCGACTACCTGAAATGATCAAAAAGTCCCCTGGCGCTGCTTTCATTGCCGACGATATCAAGACCGCC
ATGGTGGAATTCAAGACAGGACCTGAACAGCCCGTCGTGGCATACGTCAGCAAGATGGTTGCCATCCCGGAGAGC
GAGCTTCTGTCTAATAGAAAGCGTAGCGAAGGCGCCATGACTGCAGACGAAGCTCGGCAAATTGCGCGTCGCAAG
CGGGAGGAGATTGCAAAGATGCAGGCGGAAGCCCGCAGTAATGGAGAAGCAGATGACTTTGATCGTATGACATCG
ATTTTTGAAACCACCTCATTGATCACTGAGACGACTGAGGAGCCAGAAGAGCCAGTGGATAAGGAGGACCCTGAT
CATCTTATTGGTTTCGCCCGACTTTTCTCCGGAACGCTTTCGGTTGGAGATGAGATCTATGTCCTCCCGCCCAAG
TTCTCTCCAGCCAATCCGCACGCCAGCCCGGAGCCAAAGAAAGTCATAGTCACAGACCTGTACCTGATGATGGGC
AGAGCCCTCGAGCCCCTCAAATCCGTACCAGCCGGTGTGGTATTCGGAATTGGAGGTCTTGCAGGCCATGTGTTG
AAGACAGGCACCCTCTGCAGCCGACTTGATGGAGGTATCAACTTGGCCGGTGTTTCGCTGAGCATGCCGCCCATT
GTCCGAGTCGCGCTAGAACCGGTCAACCCAGCAGATCTAAGCAAACTAGTCACCGGCTTGCGCTTGCTTGAACAG
AGTGATCCATGTGCGCAGTACGAAGTGCTGCCGAGTGGTGAACACGTTATCCTCACAGCAGGTGAACTGCACTTG
GAGCGTTGTGTGACGGATCTGCGCGAGCGTTTCGCCCGTTGCGAGATCCAGACTGGTGAGGCCATCGTCCCCTAC
CGTGAAACTATTGTTCACGGCCCCGAGATGGCTGCACCCAAGAACCCCGACCTAGGACGTGGAGCCGTTGTGACG
GTCTCTGCTTCGAAGCAAATGACCCTTCGTCTGCGCGTGGTTCCGATGCCAGATGCTGTCACGGAATTCCTGACT
AAACAGGTCGGAACTATCAAGCAACTCCAATTGGAGAAGCGCTCAGAAGCTGAAGGCAAGATAGAGACCGAGAAC
GCAGCCGAAGCTGCCGTTGACGGTACTGGCGAGGCGCCTGAAGGCAACATTCTCTCCAAGCAGGAGTTCCGCGAA
GGTCTAGAGAAGTTGTTCAACGACGAGGTCAAGGAAGACAAGGAGCTATGGAAGAACGTCGTCGACCGAATTACC
GCTTTCGGGCCCCGCAGAGTCGGGCCCAACATTCTAGTTGATGCAACTGCAGTCAACACATGCGAAAAATTCTTG
GTCGATGACACCAAGCAACAGATCGACGGTGATAACCACCAGGCACTGGTCGTGCGCGATTTCAACGACAAGATC
GCGTATGCCTTCCAGCTCGCAACAGGCCAAGGTCCCTTGTGCCAGGAGCCTATGCAAGGCGTGGCCGTGTTCTTG
GAAGACTTATCTGTGCAGTCTAGCGCAGGTGACGAGCTTGACATGGGCCGGTTGACAGGCGAGTCAATCAGACTG
GTACGTGAAGGTATCTCGGCCGGTTTCCTGGACTGGAGTCCTCGTATCATGCTCGCAATGTACAGTTGCGAGATC
CAAGCGACCACCGAAGTCCTAGGCCGCGTCTACGCCGTAATCACGCGCCGCCGAGGCCGCATTCTCTCCGAAATA
ATGAAAGAAGGCACGCCATTCTTCACGATCCTGGCGCTTCTACCCGTAGCCGAGTCGTTCGGGTTCGCCGAGGAG
ATCCGAAAGAGGACGTCCGGTGCTGCGCAACCGCAACTGATCTTCGCAGGCTTCGAGGCTCTCGACGAGGATCCT
TTCTGGGTTCCTGCTACAGAGGAAGAACTTGAAGATCTGGGTGAGCTTGCGGATAAACAGAACGTTGCTAAGCGG
TATATGGATGCTGTGCGCAATCGCAAGGGTTTGGTTGTTCAGGGACGCAAGTTGATTGATGCAGAGAAGCAGAAG
ACTCTGAAGAAATAA
Gene >Pro_DTO377G3_2|g413.t1
ATGCCTGTTGTAAATGTCGACCAGCTGGTCCGCCTACAGCGGAAGCCCGAGGACATAAGAAATGTGCGTGTGCCC
CTCCATCCCACTCATATCAGGGCTTTATACTAATCTCAGCCACCAGATCTGCATTTTGGCCCACGTTGTAAGTCA
AAGAAATTTACACTTTCGTTCCAAATGAGCCTAAAATGCTCATCGCGCTTTCTTTTGCATTTTTAGGATCATGGC
AAGACATCTTTGACGGATAGTCTTATTGCCACAAATGGCATCATTTCACCCAAGCTGGCCGGTAAAATCCGCTAC
CTAGACTCTCGCCCAGATGAGCAGCTTCGAGGTATTACAATGGAGTCATCAGCTATCTCACTGTTCTTCTCGATG
CTCCGCCGTCCAAGCCCGGACGCAGAGCCAGTGACCAAAGAGTATCTGATCAATCTGATCGATTCACCTGGTCAT
ATCGATTTCAGCAGCGAGGTCTCCACCGCATCTCGTCTTTGTGACGGTGCAGTTGTGCTCGTTGACGCAGTTGAA
GGTGTTTGCAGTCAAACCGTGACAGTTTTGCGACAGACCTGGGTTGAGCAGTTAAAACCGATCTTAGTCATTAAC
AAGATGGACCGCTTGGTAACAGAGCTGAAGATGAGCCCGGCCGAGGCTTTCTCGCATCTTAGTCGACTGTTGGAA
CAGGTTAATGCTGTCATCGGTAGTTTCTACCAGGGCGAGCGCATGGAAGAAGATCTGCAGTGGCGTGAGCGTATG
GAAGATCGTGTCAATGCTGCAGCGGCTCGGGACCAAGACAACAAAAAGACATCAGCTGACGATGAGTCTGCACAA
AGCATCACTGAGGGAACTGAATTTGAGGAGCGCGACGACGAGGATCTTTATTTCGCACCTGAGAAAAATAACGTC
ATCTTCTGCAGTGCCGTTGATGGCTGGGCTTTCACAATCCGGCAATTCGCCGCCATTTACGAGAAGAAACTCGGA
ATCAAACGAACAGTTCTGGAGAAAGTCCTTTGGGGTGATTATTATTTAGACCCTAAAACTAAACGCGTCTTGGGT
GTGAAGCATCTGAGAGGACGTGCTTTAAAGCCTATGTTCGTTCAATTGGTCTTGGATAGCATTTGGGCCGCTTAT
CAAGCCACCACAGGTGGTGACAAGGGCAAAGGGTAAGTTGAAAACGAACCCAACTATCGCGTCAACGCTGATATG
ATATTGACCTTTACTAGTGACCCAGTGTTGCTGGAGAAGATTACCAAATCGCTCAACATTAACATCCCGGTATAT
GTCTTGCGCGGACGCGACCCTAGGAACATTATGAATACACTATTCTCTCAGTGGCTGCCACTATCTACTGCCTTG
CTGGTTTCCGTCATTGAATATCTCCCCAGTCCGCCCGTTGCGCAAGCTGCCCGACTACCTGAAATGATCAAAAAG
TCCCCTGGCGCTGCTTTCATTGCCGACGATATCAAGACCGCCATGGTGGAATTCAAGACAGGACCTGAACAGCCC
GTCGTGGCATACGTCAGCAAGATGGTTGCCATCCCGGAGAGCGAGCTTCTGTCTAATAGAAAGCGTAGCGAAGGC
GCCATGACTGCAGACGAAGCTCGGCAAATTGCGCGTCGCAAGCGGGAGGAGATTGCAAAGATGCAGGCGGAAGCC
CGCAGTAATGGAGAAGCAGATGACTTTGATCGTATGACATCGATTTTTGAAACCACCTCATTGATCACTGAGACG
ACTGAGGAGCCAGAAGAGCCAGTGGATAAGGAGGACCCTGATCATCTTATTGGTTTCGCCCGACTTTTCTCCGGA
ACGCTTTCGGTTGGAGATGAGATCTATGTCCTCCCGCCCAAGTTCTCTCCAGCCAATCCGCACGCCAGCCCGGAG
CCAAAGAAAGTCATAGTCACAGACCTGTACCTGATGATGGGCAGAGCCCTCGAGCCCCTCAAATCCGTACCAGCC
GGTGTGGTATTCGGAATTGGAGGTCTTGCAGGCCATGTGTTGAAGACAGGCACCCTCTGCAGCCGACTTGATGGA
GGTATCAACTTGGCCGGTGTTTCGCTGAGCATGCCGCCCATTGTCCGAGTCGCGCTAGAACCGGTCAACCCAGCA
GATCTAAGCAAACTAGTCACCGGCTTGCGCTTGCTTGAACAGAGTGATCCATGTGCGCAGTACGAAGTGCTGCCG
AGTGGTGAACACGTTATCCTCACAGCAGGTGAACTGCACTTGGAGCGTTGTGTGACGGATCTGCGCGAGCGTTTC
GCCCGTTGCGAGATCCAGACTGGTGAGGCCATCGTCCCCTACCGTGAAACTATTGTTCACGGCCCCGAGATGGCT
GCACCCAAGAACCCCGACCTAGGACGTGGAGCCGTTGTGACGGTCTCTGCTTCGAAGCAAATGACCCTTCGTCTG
CGCGTGGTTCCGATGCCAGATGCTGTCACGGAATTCCTGACTAAACAGGTCGGAACTATCAAGCAACTCCAATTG
GAGAAGCGCTCAGAAGCTGAAGGCAAGATAGAGACCGAGAACGCAGCCGAAGCTGCCGTTGACGGTACTGGCGAG
GCGCCTGAAGGCAACATTCTCTCCAAGCAGGAGTTCCGCGAAGGTCTAGAGAAGTTGTTCAACGACGAGGTCAAG
GAAGACAAGGAGCTATGGAAGAACGTCGTCGACCGAATTACCGCTTTCGGGCCCCGCAGAGTCGGGCCCAACATT
CTAGTTGATGCAACTGCAGTCAACACATGCGAAAAATTGTGAGTATAGGTTAAAAGAAACACTATATCTATCATT
TAGATCTAACATCTCCTTCCTAGCTTGGTCGATGACACCAAGCAACAGATCGACGGTGATAACCACCAGGCACTG
GTCGTGCGCGATTTCAACGACAAGATCGCGTATGCCTTCCAGCTCGCAACAGGCCAAGGTCCCTTGTGCCAGGAG
CCTATGCAAGGCGTGGCCGTGTTCTTGGAAGACTTATCTGTGCAGTCTAGCGCAGGTGACGAGCTTGACATGGGC
CGGTTGACAGGCGAGTCAATCAGACTGGTACGTGAAGGTATCTCGGCCGGTTTCCTGGACTGGAGTCCTCGTATC
ATGCTCGCAATGTACAGTTGCGAGATCCAAGCGACCAGTGAGTATTTCATTCTTCCCTTCTGTTCATGCCTTCAC
ACCACACGCGCCACACGCGAAAAGCAAACCCACAGCTAACACATCATCTTCACCCTTAAAGCCGAAGTCCTAGGC
CGCGTCTACGCCGTAATCACGCGCCGCCGAGGCCGCATTCTCTCCGAAATAATGAAAGAAGGCACGCCATTCTTC
ACGATCCTGGCGCTTCTACCCGTAGCCGAGTCGTTCGGGTTCGCCGAGGAGATCCGAAAGAGGACGTCCGGTGCT
GCGCAACCGCAACTGATCTTCGCAGGCTTCGAGGCTCTCGACGAGGATCCTTTCTGGGTTCCTGCTACAGAGGAA
GAACTTGAAGATCTGGGTGAGCTTGCGGATAAACAGAACGTTGCTAAGCGGTATATGGATGCTGTGCGCAATCGC
AAGGGTTTGGTTGTTCAGGGACGCAAGTTGATTGATGCAGAGAAGCAGAAGACTCTGAAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail