Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4117.t1
Gene name
Locationscaffold_08:48110..49037
Strand-
Gene length (bp)927
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04176 TIP41 TIP41-like family 3.6E-70 52 229

GO

GO Term Description Terminal node
GO:0043666 regulation of phosphoprotein phosphatase activity Yes
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0010921 regulation of phosphatase activity No
GO:0051174 regulation of phosphorus metabolic process No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019220 regulation of phosphate metabolic process No
GO:0050789 regulation of biological process No
GO:0031399 regulation of protein modification process No
GO:0050794 regulation of cellular process No
GO:0065009 regulation of molecular function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0051246 regulation of protein metabolic process No
GO:0019222 regulation of metabolic process No
GO:0051336 regulation of hydrolase activity No
GO:0080090 regulation of primary metabolic process No
GO:0035303 regulation of dephosphorylation No
GO:0035304 regulation of protein dephosphorylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4117.t1
MTTACVTVSPEAKKPNSITINGFRISTQKLPILKADPIEEMTQKLGIAPPEMIFGDNYVAIEHENGNWGINFNAF
DALDLVDKTGQSMLQVAYSGEWQKSREKTHEGIKEVVKPFDWSYSTDYKGTLHPNARPFEPTTKPIPIELLKRPD
PILFFDEVVLYEDELADNGITMLSCKIRVMPGRLLLLTRFFMRLDHVLIRLRDTRVYVDFATGEVIREYLSKECE
YEKVRQMLAATRDDIPAFLRDPNRLSEILPLVEKRSERLVLGD*
Coding >Pro_DTO377G3_2|g4117.t1
ATGACGACAGCATGTGTCACGGTCTCTCCGGAGGCAAAGAAACCAAATTCGATCACCATCAACGGGTTTCGAATT
TCAACACAGAAGCTACCTATTCTCAAAGCCGACCCGATCGAGGAAATGACCCAGAAACTCGGCATTGCACCCCCA
GAAATGATCTTTGGTGATAATTATGTTGCAATAGAGCACGAGAATGGTAATTGGGGCATCAATTTCAATGCGTTT
GATGCCTTGGACTTGGTGGACAAGACTGGTCAATCCATGCTCCAGGTCGCGTACTCGGGAGAATGGCAAAAGAGC
AGAGAGAAAACACACGAAGGGATTAAAGAAGTCGTGAAGCCGTTCGACTGGTCATATAGCACCGACTACAAGGGC
ACCCTCCATCCCAATGCGCGGCCGTTTGAGCCAACGACGAAGCCCATTCCGATTGAACTATTGAAGCGTCCAGAT
CCCATCCTCTTTTTTGACGAGGTTGTTCTTTATGAAGATGAGCTGGCGGACAATGGGATTACCATGCTGTCTTGC
AAGATCCGAGTCATGCCAGGAAGACTTCTTCTATTGACAAGATTCTTCATGAGGCTTGATCACGTTTTGATCCGA
CTCCGGGACACTCGAGTTTATGTGGACTTTGCCACAGGTGAAGTTATTCGAGAATATCTCTCAAAGGAATGTGAA
TATGAGAAAGTTCGACAGATGCTAGCAGCAACCAGAGATGATATTCCAGCTTTCTTGAGAGATCCCAACCGGCTC
TCTGAGATTCTCCCCCTTGTAGAAAAGCGATCCGAGCGGTTGGTGCTAGGCGATTGA
Transcript >Pro_DTO377G3_2|g4117.t1
ATGACGACAGCATGTGTCACGGTCTCTCCGGAGGCAAAGAAACCAAATTCGATCACCATCAACGGGTTTCGAATT
TCAACACAGAAGCTACCTATTCTCAAAGCCGACCCGATCGAGGAAATGACCCAGAAACTCGGCATTGCACCCCCA
GAAATGATCTTTGGTGATAATTATGTTGCAATAGAGCACGAGAATGGTAATTGGGGCATCAATTTCAATGCGTTT
GATGCCTTGGACTTGGTGGACAAGACTGGTCAATCCATGCTCCAGGTCGCGTACTCGGGAGAATGGCAAAAGAGC
AGAGAGAAAACACACGAAGGGATTAAAGAAGTCGTGAAGCCGTTCGACTGGTCATATAGCACCGACTACAAGGGC
ACCCTCCATCCCAATGCGCGGCCGTTTGAGCCAACGACGAAGCCCATTCCGATTGAACTATTGAAGCGTCCAGAT
CCCATCCTCTTTTTTGACGAGGTTGTTCTTTATGAAGATGAGCTGGCGGACAATGGGATTACCATGCTGTCTTGC
AAGATCCGAGTCATGCCAGGAAGACTTCTTCTATTGACAAGATTCTTCATGAGGCTTGATCACGTTTTGATCCGA
CTCCGGGACACTCGAGTTTATGTGGACTTTGCCACAGGTGAAGTTATTCGAGAATATCTCTCAAAGGAATGTGAA
TATGAGAAAGTTCGACAGATGCTAGCAGCAACCAGAGATGATATTCCAGCTTTCTTGAGAGATCCCAACCGGCTC
TCTGAGATTCTCCCCCTTGTAGAAAAGCGATCCGAGCGGTTGGTGCTAGGCGATTGA
Gene >Pro_DTO377G3_2|g4117.t1
ATGACGACAGCATGTGTCACGGTCTCTCCGGAGGCAAAGAAACCAAATTCGATCACCATCAACGGGTTTCGAATT
TCAACACAGAAGCTACCTATTCTCAAAGCCGACCCGATCGAGGAAATGACCCAGAAACTCGGCATTGCACCCCCA
GAAATGATCTTTGGTGATAATTATGTTGCAATAGAGCACGAGAATGGTAATTGGGGCATCAATTTCAATGCGTTT
GATGCCTTGGACTTGGTGGACAAGACTGGTCAATCCATGCTCCAGGTCGCGTACTCGGGAGAATGGCAAAAGAGC
AGGTATTTTTGCAGCCGTCTAAATTTCTGCTTATCGATCGTTGCGACTAATGGCTTGTTCCGCAGAGAGAAAACA
CACGAAGGGATTAAAGAAGTCGTGAAGCCGTTCGACTGGTCATATAGCACCGACTACAAGGGCACCCTCCATCCC
AATGCGCGGCCGTTTGAGCCAACGACGAAGCCCATTCCGATTGAACTATTGAAGCGTCCAGATCCCATCCTCTTT
TTTGACGAGGTTGTTCTTTATGAAGATGAGCTGGCGGACAATGGGATTACCATGCTGTCTTGCAAGATCCGAGTC
ATGCCAGGAAGACTTCTTCTATTGACAAGATTCTTCATGAGGCTTGATCACGTTTTGATCCGACTCCGGGACACT
CGAGTTTATGTGGACTTTGCCACAGGTGAAGTTATTCGAGAATATCTCTCAAAGGAATGTGAATATGAGAAAGTT
CGACAGGTATGTGTGGCCGTTGGATAACGTTGGATGTGTGTTTGATCTGACAGTCGTCCACAGATGCTAGCAGCA
ACCAGAGATGATATTCCAGCTTTCTTGAGAGATCCCAACCGGCTCTCTGAGATTCTCCCCCTTGTAGAAAAGCGA
TCCGAGCGGTTGGTGCTAGGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail