Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4115.t1
Gene name
Locationscaffold_08:43164..45409
Strand+
Gene length (bp)2245
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01433 Peptidase_M1 Peptidase family M1 domain 8.1E-46 234 432
PF09127 Leuk-A4-hydro_C Leukotriene A4 hydrolase, C-terminal 6.4E-36 498 609
PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain 1.4E-29 25 203

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0008237 metallopeptidase activity Yes
GO:0046914 transition metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008233 peptidase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4115.t1
MATINPPRDPNTVSNYNNWRSTHITANFDILFDQKKLVGNVVYQFKSITDGESQEIILDTSHLDIGAVKVDGQLS
KWEFLPRLEPYGVPLKIRLDTPVKLNGTVEVDIEVKTTDKCTALQWLTPAQTSNKKHPYMFSQCQAIHARSIFPC
QDTPDVKATFDFNITSPLPVITSGLPIRKESMESKADRQLYRFNQSVPIPSYLFAIASGDVVEAPIGPRSVVATS
PDKLEECKWELEADTENFIKTIEKIVYPYAWGEYNVLILPPSFPYGGMENPIFTFATPSIISKDRENIDVIAHEL
AHSWSGNLVTNASWEHFWLNEGWTVYLERRILAALHGEAYRHFSAIIGWKSLTDAVEHFGDDHEFTKLIVDLKGK
DPDDAFSSVPYEKGFNFLFHLENIVGKSKFDKFIPHYFTTFKCKSLDSYEFKALILDFFKSDAEASKVLNELDWD
KWFYAPGLPPKPSFDTSMVDVVYELSKKWQSLPDSSFKPHISDIQGLTANQLVVFLEQILLLERPLSPEVSKLMG
DVYGLTESSNIEVSHLYCQVGMKAGDDSVIEPTTDLLGRVGRMKFVRPLYRNLQKINRPVALATFEKNKDFYHPI
CRGMVEKDLFGKKDN*
Coding >Pro_DTO377G3_2|g4115.t1
ATGGCTACTATCAATCCTCCGCGGGATCCGAATACCGTGAGCAACTACAACAATTGGCGTTCCACCCATATTACG
GCCAATTTCGATATTCTGTTCGATCAGAAGAAGCTGGTGGGAAATGTCGTCTATCAATTCAAGTCAATCACCGAT
GGCGAGTCCCAGGAGATCATCCTGGATACCAGCCATCTCGACATTGGCGCGGTGAAGGTGGATGGCCAGCTATCC
AAGTGGGAGTTTCTTCCCCGGCTAGAGCCCTATGGTGTGCCATTGAAGATTCGCCTTGATACGCCCGTCAAGTTA
AATGGTACCGTTGAGGTTGATATCGAGGTGAAAACCACCGACAAGTGCACCGCGTTGCAGTGGCTGACACCTGCG
CAAACTTCAAACAAGAAACATCCATACATGTTCTCCCAATGCCAGGCAATTCACGCGCGGTCTATCTTCCCTTGT
CAGGACACTCCGGATGTCAAAGCCACCTTTGACTTCAACATCACCTCCCCGCTCCCGGTCATCACCAGCGGCCTG
CCGATTCGCAAGGAGTCAATGGAGTCAAAGGCGGACCGCCAATTGTATCGATTCAACCAGTCGGTGCCAATCCCC
AGCTACCTCTTTGCTATCGCTAGTGGTGATGTTGTCGAGGCTCCAATTGGGCCTCGGAGTGTCGTTGCAACCAGC
CCTGACAAGCTGGAAGAGTGCAAATGGGAACTCGAGGCTGATACCGAGAACTTCATCAAAACAATCGAGAAAATC
GTCTACCCTTATGCCTGGGGTGAATACAACGTTTTGATCCTGCCGCCCAGTTTCCCATATGGCGGCATGGAGAAC
CCGATCTTCACTTTCGCAACCCCGAGTATCATCTCAAAGGACCGTGAGAACATCGATGTCATTGCACACGAATTG
GCTCACAGCTGGAGTGGTAACCTGGTTACTAATGCCTCATGGGAGCACTTTTGGTTGAATGAAGGCTGGACGGTT
TACCTTGAGAGAAGGATTCTGGCTGCCCTTCATGGCGAAGCCTACCGCCACTTTTCGGCCATCATTGGGTGGAAG
TCTCTGACTGACGCTGTCGAGCATTTTGGTGACGATCATGAGTTCACGAAGCTCATCGTTGATCTGAAGGGCAAA
GATCCCGACGACGCATTCTCAAGTGTTCCCTATGAGAAGGGGTTCAACTTCTTATTTCACCTTGAGAATATTGTT
GGCAAGTCAAAATTTGACAAGTTTATTCCCCACTATTTCACAACCTTTAAGTGCAAATCACTCGACTCTTATGAG
TTCAAGGCACTGATTCTGGACTTCTTCAAGTCAGATGCCGAGGCTTCCAAGGTCTTGAACGAATTGGATTGGGAC
AAGTGGTTCTATGCGCCAGGTTTACCACCCAAGCCAAGCTTTGACACATCGATGGTGGATGTTGTTTACGAACTT
TCCAAGAAATGGCAGTCCCTTCCCGACTCTTCCTTCAAGCCTCATATTAGCGATATCCAGGGCTTGACCGCAAAC
CAATTGGTCGTCTTCTTAGAGCAGATTCTCTTGCTAGAGAGACCACTCAGCCCTGAAGTCTCGAAGTTGATGGGT
GATGTCTACGGTTTGACCGAGAGCAGTAATATTGAAGTTTCGCACCTCTACTGCCAAGTTGGCATGAAAGCAGGA
GACGACAGTGTTATTGAGCCGACAACCGACTTGCTGGGCCGCGTTGGACGGATGAAGTTTGTGCGACCTTTGTAC
CGCAATCTCCAGAAGATCAATCGCCCTGTCGCCCTCGCAACATTCGAGAAGAACAAGGATTTTTATCATCCTATA
TGCCGAGGGATGGTGGAGAAGGATCTGTTTGGCAAGAAAGACAACTAG
Transcript >Pro_DTO377G3_2|g4115.t1
ATGGCTACTATCAATCCTCCGCGGGATCCGAATACCGTGAGCAACTACAACAATTGGCGTTCCACCCATATTACG
GCCAATTTCGATATTCTGTTCGATCAGAAGAAGCTGGTGGGAAATGTCGTCTATCAATTCAAGTCAATCACCGAT
GGCGAGTCCCAGGAGATCATCCTGGATACCAGCCATCTCGACATTGGCGCGGTGAAGGTGGATGGCCAGCTATCC
AAGTGGGAGTTTCTTCCCCGGCTAGAGCCCTATGGTGTGCCATTGAAGATTCGCCTTGATACGCCCGTCAAGTTA
AATGGTACCGTTGAGGTTGATATCGAGGTGAAAACCACCGACAAGTGCACCGCGTTGCAGTGGCTGACACCTGCG
CAAACTTCAAACAAGAAACATCCATACATGTTCTCCCAATGCCAGGCAATTCACGCGCGGTCTATCTTCCCTTGT
CAGGACACTCCGGATGTCAAAGCCACCTTTGACTTCAACATCACCTCCCCGCTCCCGGTCATCACCAGCGGCCTG
CCGATTCGCAAGGAGTCAATGGAGTCAAAGGCGGACCGCCAATTGTATCGATTCAACCAGTCGGTGCCAATCCCC
AGCTACCTCTTTGCTATCGCTAGTGGTGATGTTGTCGAGGCTCCAATTGGGCCTCGGAGTGTCGTTGCAACCAGC
CCTGACAAGCTGGAAGAGTGCAAATGGGAACTCGAGGCTGATACCGAGAACTTCATCAAAACAATCGAGAAAATC
GTCTACCCTTATGCCTGGGGTGAATACAACGTTTTGATCCTGCCGCCCAGTTTCCCATATGGCGGCATGGAGAAC
CCGATCTTCACTTTCGCAACCCCGAGTATCATCTCAAAGGACCGTGAGAACATCGATGTCATTGCACACGAATTG
GCTCACAGCTGGAGTGGTAACCTGGTTACTAATGCCTCATGGGAGCACTTTTGGTTGAATGAAGGCTGGACGGTT
TACCTTGAGAGAAGGATTCTGGCTGCCCTTCATGGCGAAGCCTACCGCCACTTTTCGGCCATCATTGGGTGGAAG
TCTCTGACTGACGCTGTCGAGCATTTTGGTGACGATCATGAGTTCACGAAGCTCATCGTTGATCTGAAGGGCAAA
GATCCCGACGACGCATTCTCAAGTGTTCCCTATGAGAAGGGGTTCAACTTCTTATTTCACCTTGAGAATATTGTT
GGCAAGTCAAAATTTGACAAGTTTATTCCCCACTATTTCACAACCTTTAAGTGCAAATCACTCGACTCTTATGAG
TTCAAGGCACTGATTCTGGACTTCTTCAAGTCAGATGCCGAGGCTTCCAAGGTCTTGAACGAATTGGATTGGGAC
AAGTGGTTCTATGCGCCAGGTTTACCACCCAAGCCAAGCTTTGACACATCGATGGTGGATGTTGTTTACGAACTT
TCCAAGAAATGGCAGTCCCTTCCCGACTCTTCCTTCAAGCCTCATATTAGCGATATCCAGGGCTTGACCGCAAAC
CAATTGGTCGTCTTCTTAGAGCAGATTCTCTTGCTAGAGAGACCACTCAGCCCTGAAGTCTCGAAGTTGATGGGT
GATGTCTACGGTTTGACCGAGAGCAGTAATATTGAAGTTTCGCACCTCTACTGCCAAGTTGGCATGAAAGCAGGA
GACGACAGTGTTATTGAGCCGACAACCGACTTGCTGGGCCGCGTTGGACGGATGAAGTTTGTGCGACCTTTGTAC
CGCAATCTCCAGAAGATCAATCGCCCTGTCGCCCTCGCAACATTCGAGAAGAACAAGGATTTTTATCATCCTATA
TGCCGAGGGATGGTGGAGAAGGATCTGTTTGGCAAGAAAGACAACTAG
Gene >Pro_DTO377G3_2|g4115.t1
ATGGCTACTATCAATCCTCCGCGGGATCCGAATACCGTGAGCAACTACAACAATTGGCGTTCCACCCATATTACG
GCCAATTTCGATATTCTGTTCGATCAGAAGAAGCTGGTGGGAAATGTCGTCTATCAATTCAAGTCAATCACCGAT
GGCGAGTCCCAGGAGATCATCCTGGATACCAGCCATCTCGACATTGGCGCGGTGAAGGTGGATGGCCAGCTATCC
AAGTGGGAGTTTCTTCCCCGGCTAGAGCCCTATGGTGTGCCATTGAAGATTCGCCTTGATACGCCCGTCAAGTTA
AATGGTACCGTTGAGGTTGATGTATGTTTCATAATCATTATCCTCATGAATCTCTATCTCATTCAAATCATAGAT
CGAGGTGAAAACCACCGACAAGTGCACCGCGTTGCAGTGGCTGACACCTGCGCAAACTTCAAACAAGAAACATCC
ATACATGTGTATGTGACAATCTTGAACTCTTCTTGGAGCTCCATTAGCTGACAAACTTGCCTAGTCTCCCAATGC
CAGGCAATTCACGCGCGGTCTATCTTCCCTTGTCAGGACACTCCGGATGTCAAAGCCACCTTTGACTTCAACATC
ACCTCCCCGCTCCCGGTCATCACCAGCGGCCTGCCGATTCGCAAGGAGTCAATGGAGTCAAAGGCGGACCGCCAA
TTGTATCGATTCAACCAGTCGGTGCCAATCCCCAGCTACCTCTTTGCTATCGCTAGTGGGTAAGGATTCTTCCAC
CATTCTCAGAGGTACGGTTCATTAATGCAGAACTCCACAGTGATGTTGTCGAGGCTCCAATTGGGCCTCGGAGTG
TCGTTGCAACCAGCCCTGACAAGCTGGAAGAGTGCAAATGGGAACTCGAGGCTGATACCGAGAACTTCATCAAAA
CAATCGAGGTACACAGCCGATATTCTATTCATATCAATGTTCAATTCTGACATTGCACAGAAAATCGTCTACCCT
TATGCCTGGGGTGAATACAACGTTTTGATCCTGCCGCCCAGTTTCCCATATGGCGGCATGGAGAACCCGATCTTC
ACTTTCGCAACCCCGAGTATCATCTCAAAGGTACGTAGTATCCTCTACGCAATAGTTAGATGGACCATGATTAAT
AGCTCCCTCAGGACCGTGAGAACATCGATGTCATTGCACACGAATTGGCTCACAGCTGGAGTGGTAACCTGGTTA
CTAATGCCTCATGGGAGCACTTTTGGTTGAATGAAGGCTGGACGGTTTACCTTGAGAGAAGGATTCTGGCTGCCC
TTCATGGCGAAGCCTACCGCCACTTTTCGGCCATCATTGGGTGGAAGTCTCTGACTGACGCTGTCGAGCATTTTG
GTGACGATCATGAGTTCACGAAGCTCATCGTTGATCTGAAGGGCAAAGATCCCGACGACGCATTCTCAAGTGTTC
CCTATGAGAAGGGGTTCAACTTCTTATTTCACCTTGAGAATATTGTTGGCAAGTCAAAATTTGACAAGTTTATTC
CCCACGTACGCAATCTCTCTTCTCTCGTTCTGTTTCTTTTATTAACCCTTTCTTTTGCAGTATTTCACAACCTTT
AAGTGCAAATCACTCGACTCTTATGAGTTCAAGGCACTGATTCTGGACTTCTTCAAGTCAGATGCCGAGGCTTCC
AAGGTCTTGAACGAATTGGATTGGGACAAGTGGTTCTATGCGCCAGGTTTACCACCCAAGCCAAGCTTTGACACA
TCGATGGTGGATGTTGTTTACGAACTTTCCAAGAAATGGCAGTCCCTTCCCGACTCTTCCTTCAAGCCTCATATT
AGCGATATCCAGGGCTTGACCGCAAACCAATTGGTCGTCTTCTTAGAGCAGATTCTCTTGCTAGAGAGACCACTC
AGCCCTGAAGTCTCGAAGTTGATGGGTGATGTCTACGGTTTGACCGAGAGCAGTAATATTGAAGTTTCGCACCTC
TACTGCCAAGTTGGCATGAAAGCAGGAGACGACAGTGTTATTGAGCCGACAACCGACTTGCTGGGCCGCGTTGGA
CGGATGAAGTTTGTGCGACCTTTGTAAGATGTCCCCGTGTTAATCGCAGATTCTGTTCTTGATACTGACTTAGCA
TTTTTTCTTGTTCTTTAGGTACCGCAATCTCCAGAAGATCAATCGCCCTGTCGCCCTCGCAACATTCGAGAAGAA
CAAGGATTTTTATCATCCTATATGCCGAGGGATGGTGGAGAAGGATCTGTTTGGCAAGAAAGACAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail