Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4097.t1
Gene name
Locationscaffold_07:797392..800083
Strand-
Gene length (bp)2691
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 8.5E-05 132 161
PF08238 Sel1 Sel1 repeat 5.3E-03 172 205
PF08238 Sel1 Sel1 repeat 3.5E-03 214 240
PF08238 Sel1 Sel1 repeat 3.3E+00 314 341
PF08238 Sel1 Sel1 repeat 3.9E+00 373 402
PF08238 Sel1 Sel1 repeat 6.8E-06 405 438
PF08238 Sel1 Sel1 repeat 4.3E+00 595 626
PF08238 Sel1 Sel1 repeat 3.6E-02 631 663

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 761 780 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4097.t1
MRTPLSHFLSALLLLQTCAAGPGQPLTDQTASAATGRDADHEFTFLAGEAEPRPMTQRVENAWNTLRTIKNPVLQ
SDKSRGLLGTVTYYGRQTVRLLFLNRPSTEKPEQKINKHLTGAVEELRTAADEDRDPDAMFLLAEMNFYGNFSHP
RDFKEAFRWYHELAWLDGNNTAQNMVGFMYATGIGGAVEPDQAKALMYHEFAAETGNIRSEMTLAYRYHTGIGTP
KDCDHAIHYYKKVADKAVEYYRSGPPGGRSMVRESYRWADEEGGVYGPGASVSSSGQNARDAANASPEASVEDIL
EYLDLMSRKGELKATYTLGKMNFEGARGLPRNFRLAMKHFKVVTKKYWNKDGSVNSNPPAGLDKLASKAAGHIGL
MYLRGEGVKQHFPTALTWFRRGITNGDPMCQHWMGLMYLKGYGVPQDAFKASHYFKAAAEQDSPASESRLGALFL
DQGDVATATRYFELAARWGWMEAYYYLAEMANFGIGRQRHCGVAAAYYKMVAEKAEIVHSAFVEANAAYETGDKE
GALIPSMMAAEQGYENAQANVAYLLDEHRSVLSLNSILPWAEKARSSLMRNARLALIYWTRSSKQANIDSLVKMG
DYYLSGTGTPIDADKASTCYHNAAEAHHSAQGYWNLGWMHENGVAVDQDFHMAKRYYDLALDLSPEAYLPVKLSL
IKLRARGYWNRITNGDINPIHEEEDSKPRRTFKEWVKAFIENDEDGYYEDLYELQRGDDDEYRGLESEGHEDGYY
DDLDLDIDEGMLEGLLIVGLAAALLVLVYYRQQQQRNRQNQNANANANANAPNGDGNANDRGLFPQPGEPDFGQW
VAGGVGH*
Coding >Pro_DTO377G3_2|g4097.t1
ATGAGGACGCCGCTCTCACACTTTCTCTCGGCCCTGCTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCG
CTTACTGACCAAACAGCGTCCGCGGCAACGGGCCGCGATGCAGACCACGAATTCACGTTCCTGGCAGGGGAAGCA
GAACCCCGACCTATGACTCAACGAGTCGAGAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAA
TCCGACAAGTCGAGAGGATTACTAGGGACGGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAAC
CGCCCTTCGACCGAAAAACCCGAGCAGAAAATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAACAGCT
GCAGACGAAGACCGAGACCCGGATGCTATGTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCC
CGCGATTTCAAAGAGGCCTTCCGCTGGTACCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATG
GTCGGGTTCATGTATGCGACGGGCATCGGCGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAG
TTTGCAGCGGAAACAGGGAACATCCGCTCGGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCG
AAGGATTGTGACCATGCGATCCATTACTACAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCT
CCGGGTGGTAGGTCTATGGTTCGAGAATCTTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCC
AGTGTGTCGAGCTCGGGTCAAAATGCGCGGGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTA
GAATACTTGGATCTCATGTCCCGGAAGGGTGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGC
GCCCGGGGCTTGCCGCGGAATTTCCGACTGGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAG
GATGGGTCCGTCAACTCAAACCCCCCTGCAGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTG
ATGTACCTTCGCGGAGAGGGTGTTAAGCAACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAAC
GGGGACCCGATGTGCCAGCATTGGATGGGTCTGATGTATCTCAAGGGCTATGGTGTTCCGCAGGATGCCTTCAAG
GCATCTCACTACTTCAAAGCAGCGGCAGAGCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTG
GACCAAGGAGATGTGGCAACCGCAACACGTTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTAT
TATCTAGCTGAGATGGCCAACTTCGGTATTGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATG
GTTGCCGAAAAAGCAGAGATCGTCCACTCAGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAG
GGCGCTCTCATTCCGTCAATGATGGCAGCCGAGCAAGGCTATGAGAATGCACAGGCAAATGTGGCTTATCTGCTT
GATGAGCATCGCTCCGTACTCTCACTAAATTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGC
AATGCGCGACTGGCCTTGATTTATTGGACCCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGT
GACTACTACCTGTCTGGTACTGGTACACCTATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAA
GCCCACCACAGTGCCCAGGGCTACTGGAATTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTC
CACATGGCCAAGCGATATTATGATTTGGCTCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTG
ATCAAACTCCGGGCTCGAGGATACTGGAATCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGAC
TCGAAGCCCCGTCGTACCTTCAAGGAATGGGTCAAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGAC
CTTTATGAACTACAACGGGGTGATGATGATGAATATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTAT
GATGACCTGGACCTTGATATCGACGAGGGAATGCTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTG
GTTTTGGTATACTACCGTCAGCAGCAGCAGCGCAACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAAT
GCCCCGAATGGAGATGGGAATGCCAACGACCGTGGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGG
GTAGCAGGAGGAGTTGGTCATTGA
Transcript >Pro_DTO377G3_2|g4097.t1
ATGAGGACGCCGCTCTCACACTTTCTCTCGGCCCTGCTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCG
CTTACTGACCAAACAGCGTCCGCGGCAACGGGCCGCGATGCAGACCACGAATTCACGTTCCTGGCAGGGGAAGCA
GAACCCCGACCTATGACTCAACGAGTCGAGAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAA
TCCGACAAGTCGAGAGGATTACTAGGGACGGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAAC
CGCCCTTCGACCGAAAAACCCGAGCAGAAAATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAACAGCT
GCAGACGAAGACCGAGACCCGGATGCTATGTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCC
CGCGATTTCAAAGAGGCCTTCCGCTGGTACCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATG
GTCGGGTTCATGTATGCGACGGGCATCGGCGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAG
TTTGCAGCGGAAACAGGGAACATCCGCTCGGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCG
AAGGATTGTGACCATGCGATCCATTACTACAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCT
CCGGGTGGTAGGTCTATGGTTCGAGAATCTTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCC
AGTGTGTCGAGCTCGGGTCAAAATGCGCGGGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTA
GAATACTTGGATCTCATGTCCCGGAAGGGTGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGC
GCCCGGGGCTTGCCGCGGAATTTCCGACTGGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAG
GATGGGTCCGTCAACTCAAACCCCCCTGCAGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTG
ATGTACCTTCGCGGAGAGGGTGTTAAGCAACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAAC
GGGGACCCGATGTGCCAGCATTGGATGGGTCTGATGTATCTCAAGGGCTATGGTGTTCCGCAGGATGCCTTCAAG
GCATCTCACTACTTCAAAGCAGCGGCAGAGCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTG
GACCAAGGAGATGTGGCAACCGCAACACGTTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTAT
TATCTAGCTGAGATGGCCAACTTCGGTATTGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATG
GTTGCCGAAAAAGCAGAGATCGTCCACTCAGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAG
GGCGCTCTCATTCCGTCAATGATGGCAGCCGAGCAAGGCTATGAGAATGCACAGGCAAATGTGGCTTATCTGCTT
GATGAGCATCGCTCCGTACTCTCACTAAATTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGC
AATGCGCGACTGGCCTTGATTTATTGGACCCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGT
GACTACTACCTGTCTGGTACTGGTACACCTATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAA
GCCCACCACAGTGCCCAGGGCTACTGGAATTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTC
CACATGGCCAAGCGATATTATGATTTGGCTCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTG
ATCAAACTCCGGGCTCGAGGATACTGGAATCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGAC
TCGAAGCCCCGTCGTACCTTCAAGGAATGGGTCAAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGAC
CTTTATGAACTACAACGGGGTGATGATGATGAATATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTAT
GATGACCTGGACCTTGATATCGACGAGGGAATGCTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTG
GTTTTGGTATACTACCGTCAGCAGCAGCAGCGCAACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAAT
GCCCCGAATGGAGATGGGAATGCCAACGACCGTGGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGG
GTAGCAGGAGGAGTTGGTCATTGA
Gene >Pro_DTO377G3_2|g4097.t1
ATGAGGACGCCGCTCTCACACTTTCTCTCGGCCCTGCGTAAGATTTGCCCGCACCTGCAGGCCCGCATCGGAAAC
TGACACCCCTTTTCAGTGCTATTGCAGACATGCGCAGCTGGGCCTGGTCAGCCGCTTACTGACCAAACAGCGTCC
GCGGCAACGGGCCGCGATGCAGACCACGAATTCACGTTCCTGGCAGGGGAAGCAGAACCCCGACCTATGACTCGT
GAGTAGAGACGACTTGTGCCTTATCGCCTGACGCTTGATACTGATTGCCTTCATCGTGATTATAGAACGAGTCGA
GAATGCCTGGAATACCCTTCGCACAATAAAGAATCCAGTCCTTCAATCCGACAAGTCGAGAGGATTACTAGGGAC
GGTCACATACTATGGCCGTCAAACGGTCCGACTGCTATTCTTGAACCGCCCTTCGACCGAAAAACCCGAGCAGAA
AATAAACAAACATCTGACGGGAGCAGTGGAGGAGCTGAGAACAGCTGCAGACGAAGACCGAGACCCGGATGCTAT
GTTCTTGTTAGCAGAGATGAACTTCTATGGCAACTTCTCCCATCCCCGCGATTTCAAAGAGGCCTTCCGCTGGTA
CCACGAACTAGCATGGTTGGACGGAAACAACACAGCGCAGAACATGGTCGGGTTCATGTATGCGACGGGCATCGG
CGGTGCGGTCGAACCCGACCAGGCAAAGGCCCTGATGTACCACGAGTTTGCAGCGGAAACAGGGAACATCCGCTC
GGAGATGACACTTGCGTATCGCTACCACACTGGTATCGGAACGCCGAAGGATTGTGACCATGCGATCCATTACTA
CAAGAAGGTTGCGGACAAGGCGGTCGAGTACTACCGCTCAGGCCCTCCGGGTGGTAGGTCTATGGTTCGAGAATC
TTATCGTTGGGCAGACGAAGAAGGTGGTGTCTACGGTCCAGGAGCCAGTGTGTCGAGCTCGGGTCAAAATGCGCG
GGACGCTGCCAATGCCTCTCCTGAGGCCAGCGTGGAAGATATACTAGAATACTTGGATCTCATGTCCCGGAAGGG
TGAACTGAAGGCTACATACACCCTCGGTAAGATGAACTTCGAGGGCGCCCGGGGCTTGCCGCGGAATTTCCGACT
GGCTATGAAGCATTTCAAGGTTGTTACCAAGAAATATTGGAACAAGGATGGGTCCGTCAACTCAAACCCCCCTGC
AGGGCTTGATAAACTGGCATCCAAGGCCGCAGGACATATTGGCCTGATGTACCTTCGCGGAGAGGGTGTTAAGCA
ACACTTCCCGACTGCCCTCACATGGTTCCGGAGGGGTATTACGAACGGGGACCCGATGTGCCAGCATTGGATGGG
TCTGATGTATCTCAAGGGCTATGGTGTTCCGCAGGATGCCTTCAAGGCATCTCACTACTTCAAAGCAGCGGCAGA
GCAGGATTCCCCTGCGTCAGAATCACGATTAGGCGCTCTGTTCTTGGACCAAGGAGATGTGGCAACCGCAACACG
TTACTTCGAGCTTGCCGCCCGCTGGGGCTGGATGGAGGCGTACTATTATCTAGCTGAGATGGCCAACTTCGGTAT
TGGCAGACAGCGTCACTGTGGTGTGGCCGCTGCCTACTATAAAATGGTTGCCGAAAAAGCAGAGATCGTCCACTC
AGCTTTCGTGGAGGCAAACGCTGCTTACGAAACCGGTGATAAGGAGGGCGCTCTCATTCCGTCAATGATGGCAGC
CGAGCAAGGCTATGAGAATGCACAGGCAAATGTGGCTTATCTGCTTGATGAGCATCGCTCCGTACTCTCACTAAA
TTCCATCCTTCCATGGGCTGAGAAGGCTCGATCCTCCTTGATGCGCAATGCGCGACTGGCCTTGATTTATTGGAC
CCGCTCTTCGAAGCAAGCCAACATCGACTCTTTGGTCAAGATGGGTGACTACTACCTGTCTGGTACTGGTACACC
TATCGATGCCGACAAGGCCTCGACCTGTTACCACAATGCTGCTGAAGCCCACCACAGTGCCCAGGGCTACTGGAA
TTTGGGATGGATGCATGAGAATGGCGTGGCAGTAGATCAGGATTTCCACATGGCCAAGCGATATTATGATTTGGC
TCTTGACCTCAGCCCCGAAGCGTATCTGCCAGTGAAGCTCAGCTTGATCAAACTCCGGGCTCGAGGATACTGGAA
TCGCATCACTAACGGAGACATTAACCCCATCCATGAGGAGGAAGGTAAGCTGCTCCTTCGCTCTTACCCCGTGAA
ATTAATCGCGTTCTAGTTTCTTACTTACGTTTATCACTAGACTCGAAGCCCCGTCGTACCTTCAAGGAATGGGTC
AAGGCTTTCATCGAGAACGACGAGGATGGCTATTACGAAGACCTTTATGAACTACAACGGGGTGATGATGATGAA
TATCGTGGCTTGGAATCCGAAGGCCACGAAGATGGCTACTATGATGACCTGGACCTTGATATCGACGAGGGAATG
CTCGAGGGTCTCCTCATTGTCGGACTGGCTGCTGCGCTGTTGGTTTTGGTATACTACCGTCAGCAGCAGCAGCGC
AACCGACAGAACCAGAACGCCAATGCCAACGCTAACGCCAATGCCCCGAATGGAGATGGGAATGCCAACGACCGT
GGATTATTCCCTCAGCCTGGTGAACCTGACTTTGGGCAATGGGTAGCAGGAGGAGTTGGTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail