Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4089.t1
Gene name
Locationscaffold_07:783010..785250
Strand+
Gene length (bp)2240
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13418 Kelch_4 Galactose oxidase, central domain 4.9E-05 38 83
PF13418 Kelch_4 Galactose oxidase, central domain 1.1E-06 89 128
PF13418 Kelch_4 Galactose oxidase, central domain 8.4E-05 194 229
PF07646 Kelch_2 Kelch motif 9.1E-06 140 188
PF13415 Kelch_3 Galactose oxidase, central domain 2.0E-08 46 96
PF01344 Kelch_1 Kelch motif 7.4E-05 141 188
PF00651 BTB BTB/POZ domain 6.7E-09 478 578

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4089.t1
MQDAYLMPTSQAGGRRTSADYRPSIKKAQGHVPACLVNASVTYCSNDRIYAFGGFDQFTDEVYNHVLRLDLETLR
WELVDNYGDIPGVRMGHTATLYQGDKLIVFGGENEHREYLSDVVILDLNTFTWALPEIRGSIPRGRARHAAVIHE
DKLFIVGGVTGVGGVTGEKNVILDDLTYLDLQTWTWSRTWSFTARFDHTAWVWGTRLWIFGGLGPNMERTTDIWW
LDLKGSPSLAGNTTPQDSISSPHQMSPRSGIYAANSGSVQVRNLGRRKPVAPGAISCLRFDSGPHVPSLFSGTHF
HSFASGVLLDLITPSETVRSHDCNLSALDLNSLRWQRLADGQEIFRPGYRWHYCTVNDTGTKAWLLGCSLDIANV
PGGSDENHMSEVLTIDLEKYGLLGNGLSSEPPEQGAPWPSDPMGSSQVSGLGTDLAAVFDEPPESGSGTDFVITA
IRDDHDGSISEDMGDTPSVSPTQTQPTFVAQNRWTSEPIHVHLIILQVRWPHFKRLYSAQMAEYHTKRMHIPEPY
SVVRAFLYYLYTDSISGHPDYCLSAIDVAGMLVMANLYDMPKLRLLCVNRLSQELDVDNAAIIWERAGRTNEHWL
MRRAAQFCMTYWGRVVRTDGFKSLSHQSLIQLCEVVDTEGRVFAGPELEMVTFGADCLSDRDKTSRMRLGSTADE
MSEADADDEGMEIS*
Coding >Pro_DTO377G3_2|g4089.t1
ATGCAGGACGCCTACCTGATGCCTACCAGCCAGGCCGGCGGTCGTCGGACCAGCGCCGATTATCGACCCAGCATA
AAAAAGGCCCAGGGCCATGTCCCCGCGTGCCTGGTCAATGCCTCGGTGACGTACTGCAGCAATGATCGCATTTAT
GCGTTCGGGGGTTTTGACCAGTTTACTGATGAAGTTTACAACCACGTGCTCCGGCTGGACTTGGAGACTTTGCGC
TGGGAGCTCGTGGACAACTATGGCGATATCCCCGGAGTTCGCATGGGGCATACGGCGACATTGTACCAAGGGGAT
AAATTGATTGTGTTTGGAGGCGAAAATGAGCATCGCGAATACCTCTCCGACGTTGTCATCCTTGATCTCAATACC
TTCACCTGGGCACTCCCCGAAATTCGCGGGTCGATCCCGCGTGGCCGCGCCCGCCATGCTGCCGTCATTCACGAA
GACAAGCTTTTTATTGTGGGCGGAGTGACAGGTGTGGGAGGCGTGACAGGGGAGAAGAATGTGATATTGGATGAT
TTGACCTATTTGGATCTACAAACATGGACTTGGTCTCGGACATGGAGCTTCACTGCTCGCTTCGATCATACCGCT
TGGGTTTGGGGCACACGGCTGTGGATATTTGGTGGATTGGGTCCGAACATGGAACGGACTACTGATATCTGGTGG
CTCGACCTCAAGGGATCTCCTTCGTTGGCTGGAAACACCACTCCCCAAGACTCTATATCTAGTCCTCATCAAATG
TCTCCCCGCTCCGGAATCTACGCTGCCAATTCAGGCAGTGTGCAGGTACGCAATTTGGGTCGACGCAAGCCAGTC
GCGCCCGGTGCCATATCTTGTCTTAGGTTTGATTCTGGTCCTCATGTCCCCTCCTTGTTTTCTGGTACTCATTTT
CATTCATTCGCCTCTGGTGTCCTGCTCGACCTAATCACGCCGTCGGAGACCGTACGGTCGCATGATTGTAACCTG
TCGGCTCTGGACCTCAACTCGCTGCGCTGGCAACGGCTGGCTGATGGTCAAGAGATCTTTCGGCCGGGATATCGA
TGGCACTATTGCACAGTCAATGACACGGGTACCAAAGCATGGCTCTTGGGATGTAGTCTTGATATCGCGAATGTA
CCAGGCGGAAGCGACGAGAATCATATGAGTGAAGTCCTGACTATCGATTTGGAAAAGTATGGTTTACTAGGTAAC
GGACTGTCGTCAGAACCCCCCGAACAAGGCGCACCTTGGCCGTCAGATCCAATGGGCTCCTCTCAGGTTTCCGGG
CTCGGGACCGATCTAGCCGCTGTTTTCGACGAACCTCCTGAGTCTGGAAGTGGTACAGACTTTGTCATCACTGCT
ATTCGTGACGATCATGACGGGTCCATATCGGAAGATATGGGCGACACGCCGTCCGTTTCCCCAACCCAGACCCAG
CCGACCTTTGTGGCGCAGAACCGCTGGACCTCAGAGCCCATCCATGTCCATCTTATCATTCTCCAGGTCAGGTGG
CCACATTTCAAACGCCTGTACTCCGCCCAGATGGCTGAGTACCACACCAAGCGGATGCACATCCCCGAGCCTTAT
TCTGTCGTGCGCGCGTTTCTCTACTACCTGTACACAGACAGTATCTCCGGCCATCCAGACTATTGCTTGAGTGCC
ATCGATGTGGCGGGTATGCTTGTTATGGCCAATCTTTATGACATGCCGAAGCTTCGTCTGCTGTGTGTCAATAGG
TTAAGCCAAGAGCTTGACGTAGACAACGCGGCCATCATTTGGGAACGTGCGGGGCGGACCAATGAACACTGGTTG
ATGCGCCGAGCAGCACAGTTTTGCATGACATACTGGGGCCGTGTGGTACGGACAGACGGGTTTAAATCCCTCAGC
CACCAGAGTTTGATTCAACTCTGCGAAGTGGTGGATACAGAAGGTCGCGTCTTCGCAGGGCCTGAATTGGAGATG
GTCACATTCGGAGCAGATTGCCTAAGTGACCGAGATAAGACCTCTCGAATGCGGCTGGGATCTACTGCCGATGAG
ATGTCCGAGGCCGACGCAGACGATGAAGGGATGGAGATCTCATGA
Transcript >Pro_DTO377G3_2|g4089.t1
ATGCAGGACGCCTACCTGATGCCTACCAGCCAGGCCGGCGGTCGTCGGACCAGCGCCGATTATCGACCCAGCATA
AAAAAGGCCCAGGGCCATGTCCCCGCGTGCCTGGTCAATGCCTCGGTGACGTACTGCAGCAATGATCGCATTTAT
GCGTTCGGGGGTTTTGACCAGTTTACTGATGAAGTTTACAACCACGTGCTCCGGCTGGACTTGGAGACTTTGCGC
TGGGAGCTCGTGGACAACTATGGCGATATCCCCGGAGTTCGCATGGGGCATACGGCGACATTGTACCAAGGGGAT
AAATTGATTGTGTTTGGAGGCGAAAATGAGCATCGCGAATACCTCTCCGACGTTGTCATCCTTGATCTCAATACC
TTCACCTGGGCACTCCCCGAAATTCGCGGGTCGATCCCGCGTGGCCGCGCCCGCCATGCTGCCGTCATTCACGAA
GACAAGCTTTTTATTGTGGGCGGAGTGACAGGTGTGGGAGGCGTGACAGGGGAGAAGAATGTGATATTGGATGAT
TTGACCTATTTGGATCTACAAACATGGACTTGGTCTCGGACATGGAGCTTCACTGCTCGCTTCGATCATACCGCT
TGGGTTTGGGGCACACGGCTGTGGATATTTGGTGGATTGGGTCCGAACATGGAACGGACTACTGATATCTGGTGG
CTCGACCTCAAGGGATCTCCTTCGTTGGCTGGAAACACCACTCCCCAAGACTCTATATCTAGTCCTCATCAAATG
TCTCCCCGCTCCGGAATCTACGCTGCCAATTCAGGCAGTGTGCAGGTACGCAATTTGGGTCGACGCAAGCCAGTC
GCGCCCGGTGCCATATCTTGTCTTAGGTTTGATTCTGGTCCTCATGTCCCCTCCTTGTTTTCTGGTACTCATTTT
CATTCATTCGCCTCTGGTGTCCTGCTCGACCTAATCACGCCGTCGGAGACCGTACGGTCGCATGATTGTAACCTG
TCGGCTCTGGACCTCAACTCGCTGCGCTGGCAACGGCTGGCTGATGGTCAAGAGATCTTTCGGCCGGGATATCGA
TGGCACTATTGCACAGTCAATGACACGGGTACCAAAGCATGGCTCTTGGGATGTAGTCTTGATATCGCGAATGTA
CCAGGCGGAAGCGACGAGAATCATATGAGTGAAGTCCTGACTATCGATTTGGAAAAGTATGGTTTACTAGGTAAC
GGACTGTCGTCAGAACCCCCCGAACAAGGCGCACCTTGGCCGTCAGATCCAATGGGCTCCTCTCAGGTTTCCGGG
CTCGGGACCGATCTAGCCGCTGTTTTCGACGAACCTCCTGAGTCTGGAAGTGGTACAGACTTTGTCATCACTGCT
ATTCGTGACGATCATGACGGGTCCATATCGGAAGATATGGGCGACACGCCGTCCGTTTCCCCAACCCAGACCCAG
CCGACCTTTGTGGCGCAGAACCGCTGGACCTCAGAGCCCATCCATGTCCATCTTATCATTCTCCAGGTCAGGTGG
CCACATTTCAAACGCCTGTACTCCGCCCAGATGGCTGAGTACCACACCAAGCGGATGCACATCCCCGAGCCTTAT
TCTGTCGTGCGCGCGTTTCTCTACTACCTGTACACAGACAGTATCTCCGGCCATCCAGACTATTGCTTGAGTGCC
ATCGATGTGGCGGGTATGCTTGTTATGGCCAATCTTTATGACATGCCGAAGCTTCGTCTGCTGTGTGTCAATAGG
TTAAGCCAAGAGCTTGACGTAGACAACGCGGCCATCATTTGGGAACGTGCGGGGCGGACCAATGAACACTGGTTG
ATGCGCCGAGCAGCACAGTTTTGCATGACATACTGGGGCCGTGTGGTACGGACAGACGGGTTTAAATCCCTCAGC
CACCAGAGTTTGATTCAACTCTGCGAAGTGGTGGATACAGAAGGTCGCGTCTTCGCAGGGCCTGAATTGGAGATG
GTCACATTCGGAGCAGATTGCCTAAGTGACCGAGATAAGACCTCTCGAATGCGGCTGGGATCTACTGCCGATGAG
ATGTCCGAGGCCGACGCAGACGATGAAGGGATGGAGATCTCATGA
Gene >Pro_DTO377G3_2|g4089.t1
ATGCAGGACGCCTACCTGATGCCTACCAGCCAGGCCGGCGGTCGTCGGACCAGCGCCGATTATCGACCCAGCATA
AAAAAGGCCCAGGGCCATGTCCCCGCGTGCCTGGTCAATGCCTCGGTGACGTACTGCAGCAATGATCGCATTTAT
GCGTTCGGGGGTTTTGACCAGTTTACTGATGAAGGTTCACATCACCTTAAGCTATAATTCTAAAATGGCACTAAT
GATTTTTAGTTTACAACCACGTGCTCCGGCTGGACTTGGAGACTTTGCGCTGGGAGCTCGTGGACAACTATGGCG
ATATCCCCGGAGTTCGCATGGGTAATGATTCTCTCTTCTCATTCGTCCATGTTTAGTGATAAACACTCTGACTGG
AAATCTTATTTTTTATAGGGCATACGGCGACATTGTACCAAGGGGATAAATTGATTGTGTTTGGAGGCGAAAATG
AGCATCGCGAATACCTCTCCGACGTTGTCATCCTTGATCTCAATACCTTCACCTGGGCACTCCCCGAAATTCGCG
GGTCGATCCCGCGTGGCCGCGCCCGCCATGCTGCCGTCATTCACGAAGACAAGCTTTTTATTGTGGGCGGAGTGA
CAGGTGTGGGAGGCGTGACAGGGGAGAAGAATGTGATATTGGATGATTTGACCTATTTGGATCTACAAACATGGA
CTTGGTCTCGGACATGGAGCTTCACTGCTCGCTTCGATCATACCGCTTGGGTTTGGGGCACACGGCTGTGGATAT
TTGGTGGATTGGGTCCGAACATGGAACGGACTACTGATATCTGGTGGCTCGACCTCAAGGGATCTCCTTCGTTGG
CTGGAAACACCACTCCCCAAGGTAGCGTCAACTCCCTGGGCATCAATATTTCGGGGGCTTATCTCCCAGACTCTA
TATCTAGTCCTCATCAAATGTCTCCCCGCTCCGGAATCTACGCTGCCAATTCAGGCAGTGTGCAGGTACGCAATT
TGGGTCGACGCAAGCCAGTCGCGCCCGGTGCCATATCTTGTCTTAGGTTTGATTCTGGTCCTCATGTCCCCTCCT
TGTTTTCTGGTACTCATTTTCATTCATTCGCCTCTGGTGTCCTGCTCGACCTAATCACGCCGTCGGAGACCGTAC
GGTCGCATGATTGTAACCTGTCGGCTCTGGACCTCAACTCGCTGCGCTGGCAACGGCTGGCTGATGGTCAAGAGA
TCTTTCGGCCGGGATATCGATGGCACTATTGCACAGTCAATGACACGGGTACCAAAGCATGGCTCTTGGGATGTA
GTCTTGATATCGCGAATGTACCAGGCGGAAGCGACGAGAATCATATGAGTGAAGTCCTGACTATCGATTTGGAAA
AGTATGGTTTACTAGGTAACGGACTGTCGTCAGAACCCCCCGAACAAGGCGCACCTTGGCCGTCAGATCCAATGG
GCTCCTCTCAGGTTTCCGGGCTCGGGACCGATCTAGCCGCTGTTTTCGACGAACCTCCTGAGTCTGGAAGTGGTA
CAGACTTTGTCATCACTGCTATTCGTGACGATCATGACGGGTCCATATCGGAAGATATGGGCGACACGCCGTCCG
TTTCCCCAACCCAGACCCAGCCGACCTTTGTGGCGCAGAACCGCTGGACCTCAGAGCCCATCCATGTCCATCTTA
TCATTCTCCAGGTCAGGTGGCCACATTTCAAACGCCTGTACTCCGCCCAGATGGCTGAGTACCACACCAAGCGGA
TGCACATCCCCGAGCCTTATTCTGTCGTGCGCGCGTTTCTCTACTACCTGTACACAGACAGTATCTCCGGCCATC
CAGACTATTGCTTGAGTGCCATCGATGTGGCGGGTATGCTTGTTATGGCCAATCTTTATGACATGCCGAAGCTTC
GTCTGCTGTGTGTCAATAGGTTAAGCCAAGAGCTTGACGTAGACAACGCGGCCATCATTTGGGAACGTGCGGGGC
GGACCAATGAACACTGGTTGATGCGCCGAGCAGCACAGTTTTGCATGACATACTGGGGCCGTGTGGTACGGACAG
ACGGGTTTAAATCCCTCAGCCACCAGAGTTTGATTCAACTCTGCGAAGTGGTGGATACAGAAGGTCGCGTCTTCG
CAGGGCCTGAATTGGAGATGGTCACATTCGGAGCAGATTGCCTAAGTGACCGAGATAAGACCTCTCGAATGCGGC
TGGGATCTACTGCCGATGAGATGTCCGAGGCCGACGCAGACGATGAAGGGATGGAGATCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail