Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4087.t1
Gene name
Locationscaffold_07:778322..779876
Strand-
Gene length (bp)1554
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03153 TFIIA Transcription factor IIA, alpha/beta subunit 2.1E-82 9 371

GO

GO Term Description Terminal node
GO:0005672 transcription factor TFIIA complex Yes
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0044798 nuclear transcription factor complex No
GO:0032774 RNA biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0044446 intracellular organelle part No
GO:0071704 organic substance metabolic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044464 cell part No
GO:0044428 nuclear part No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0044424 intracellular part No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044422 organelle part No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044451 nucleoplasm part No
GO:0090575 RNA polymerase II transcription factor complex No
GO:0005667 transcription factor complex No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4087.t1
MSNQQVGAVFEKVIQEVCDASQVDFEESGVDQQTLHDLRETWQHKLSSVNVAHFPWDPAPQPAQQHSVPLPTATV
PSNVPRQQPPQPQYVHQPVSIPQVAPSHTMPPMGGPRIKTEPGSNGQPGMQHLTTPMPPHGLNPQSARDRAANAL
HQKYGAAAANSVHQMQAQAQAGQGYPQMHPNAHGQMPQIKQEQAYPHMGPGQTDGGGDPLTDWKAEVARRRAAAE
SGEGDRLLREHLKQRMSQYEAGGLLRPLEEHESSSRVARRVALTAPLSQDTPGSPSSTPRVTGQFDGAEDDIKEE
DEDAINSDLDDPDDLVADDHDADESEGQVMLCTYDKVQRVKNKWKCTLKDGILTTGGKEYVFHKGQGEFEW*
Coding >Pro_DTO377G3_2|g4087.t1
ATGTCCAACCAGCAAGTGGGTGCGGTGTTCGAGAAGGTCATCCAGGAGGTCTGTGATGCCTCCCAGGTCGATTTT
GAGGAAAGTGGTGTCGATCAGCAGACTCTGCATGATCTCCGTGAGACCTGGCAACACAAGCTTTCTTCTGTGAAC
GTCGCTCATTTCCCCTGGGATCCTGCTCCTCAGCCTGCTCAACAGCACTCTGTTCCCCTCCCCACCGCCACTGTC
CCCTCCAACGTTCCCCGACAACAACCTCCCCAGCCGCAATATGTCCACCAGCCTGTTTCAATTCCCCAAGTTGCG
CCCTCGCACACTATGCCTCCCATGGGTGGGCCTCGCATCAAGACCGAGCCCGGATCCAACGGCCAACCCGGAATG
CAGCACTTGACCACACCCATGCCCCCGCATGGTCTTAACCCTCAGTCGGCTCGCGACCGTGCTGCAAATGCGCTT
CACCAGAAATACGGCGCCGCAGCCGCCAACTCCGTCCACCAAATGCAAGCCCAGGCCCAAGCTGGACAAGGATAT
CCGCAGATGCACCCCAATGCCCATGGGCAAATGCCACAAATCAAACAAGAACAGGCCTACCCACACATGGGTCCT
GGACAGACTGATGGTGGAGGTGACCCATTGACCGACTGGAAGGCAGAGGTAGCACGCCGTAGAGCAGCTGCCGAG
AGTGGAGAAGGTGACCGACTTCTGCGCGAGCATCTCAAGCAGCGCATGTCTCAGTATGAGGCCGGTGGTCTCCTT
CGTCCCTTGGAAGAGCATGAGTCCTCTTCTAGGGTCGCTCGCCGTGTGGCTCTCACAGCTCCTCTCAGCCAAGAT
ACCCCCGGGTCACCTTCATCTACCCCCCGCGTCACTGGCCAGTTTGATGGTGCAGAAGACGATATCAAGGAGGAA
GATGAAGACGCCATCAATTCGGACCTGGATGATCCAGATGACCTCGTTGCCGATGACCATGACGCAGATGAATCG
GAGGGCCAGGTCATGCTTTGCACATACGATAAAGTCCAGCGCGTGAAGAACAAGTGGAAGTGCACTCTGAAGGAT
GGCATCTTGACCACTGGTGGCAAAGAATACGTCTTCCACAAGGGCCAGGGTGAATTCGAATGGTAG
Transcript >Pro_DTO377G3_2|g4087.t1
ATGTCCAACCAGCAAGTGGGTGCGGTGTTCGAGAAGGTCATCCAGGAGGTCTGTGATGCCTCCCAGGTCGATTTT
GAGGAAAGTGGTGTCGATCAGCAGACTCTGCATGATCTCCGTGAGACCTGGCAACACAAGCTTTCTTCTGTGAAC
GTCGCTCATTTCCCCTGGGATCCTGCTCCTCAGCCTGCTCAACAGCACTCTGTTCCCCTCCCCACCGCCACTGTC
CCCTCCAACGTTCCCCGACAACAACCTCCCCAGCCGCAATATGTCCACCAGCCTGTTTCAATTCCCCAAGTTGCG
CCCTCGCACACTATGCCTCCCATGGGTGGGCCTCGCATCAAGACCGAGCCCGGATCCAACGGCCAACCCGGAATG
CAGCACTTGACCACACCCATGCCCCCGCATGGTCTTAACCCTCAGTCGGCTCGCGACCGTGCTGCAAATGCGCTT
CACCAGAAATACGGCGCCGCAGCCGCCAACTCCGTCCACCAAATGCAAGCCCAGGCCCAAGCTGGACAAGGATAT
CCGCAGATGCACCCCAATGCCCATGGGCAAATGCCACAAATCAAACAAGAACAGGCCTACCCACACATGGGTCCT
GGACAGACTGATGGTGGAGGTGACCCATTGACCGACTGGAAGGCAGAGGTAGCACGCCGTAGAGCAGCTGCCGAG
AGTGGAGAAGGTGACCGACTTCTGCGCGAGCATCTCAAGCAGCGCATGTCTCAGTATGAGGCCGGTGGTCTCCTT
CGTCCCTTGGAAGAGCATGAGTCCTCTTCTAGGGTCGCTCGCCGTGTGGCTCTCACAGCTCCTCTCAGCCAAGAT
ACCCCCGGGTCACCTTCATCTACCCCCCGCGTCACTGGCCAGTTTGATGGTGCAGAAGACGATATCAAGGAGGAA
GATGAAGACGCCATCAATTCGGACCTGGATGATCCAGATGACCTCGTTGCCGATGACCATGACGCAGATGAATCG
GAGGGCCAGGTCATGCTTTGCACATACGATAAAGTCCAGCGCGTGAAGAACAAGTGGAAGTGCACTCTGAAGGAT
GGCATCTTGACCACTGGTGGCAAAGAATACGTCTTCCACAAGGGCCAGGGTGAATTCGAATGGTAG
Gene >Pro_DTO377G3_2|g4087.t1
ATGTCCAACCAGCAAGTGGTAAGTCCCAACTCTTCTCTGGCGACCACCTGTCTATCCCCAGCTGTCGCTCGCATA
GCGACTTACTCTTGACTCATAACCATGTTCTCCCAATCCATCTTGGGGATTCCATTGAAATAAGAGCTGACATAT
GTGCCTTCATAGGGTGCGGTGTTCGAGAAGGTCATCCAGGAGGTCTGTGATGCCTCCCAGGTCGATTTTGAGGAA
AGTGGTGTCGATCAGCAGACTCTGCATGATCTCCGTGAGGTTAGTAGCATATTTCCCTACCCATATTGTCCATCT
TGTGTTGTCAAAGTCTGGTGTGCATGATTTCCCCAAAAGCGGGGATGGGCGAGGTGGTGCGGGAGGCGGTGCTTA
TGGGGGGACACCGGCTTATGAGTGCTCCCTTTATATGTGCCGCTCATACCCGCTTAGGCGCTTTTAGACCGCCAA
GACTCAGTCTCTTCTTGATTATCTCATACAGCAGACCCGACACTAATTAATATCTATACAGACCTGGCAACACAA
GCTTTCTTCTGTGAACGTCGCTCATTTCCCCTGGGATCCTGCTCCTCAGCCTGCTCAACAGCACTCTGTTCCCCT
CCCCACCGCCACTGTCCCCTCCAACGTTCCCCGACAACAACCTCCCCAGCCGCAATATGTCCACCAGCCTGTTTC
AATTCCCCAAGTTGCGCCCTCGCACACTATGCCTCCCATGGGTGGGCCTCGCATCAAGACCGAGCCCGGATCCAA
CGGCCAACCCGGAATGCAGCACTTGACCACACCCATGCCCCCGCATGGTCTTAACCCTCAGTCGGCTCGCGACCG
TGCTGCAAATGCGCTTCACCAGAAATACGGCGCCGCAGCCGCCAACTCCGTCCACCAAATGCAAGCCCAGGCCCA
AGCTGGACAAGGATATCCGCAGATGCACCCCAATGCCCATGGGCAAATGCCACAAATCAAACAAGAACAGGCCTA
CCCACACATGGGTCCTGGACAGACTGATGGTGGAGGTGACCCATTGACCGACTGGAAGGCAGAGGTAGCACGCCG
TAGAGCAGCTGCCGAGAGTGGAGAAGGTGACCGACTTCTGCGCGAGCATCTCAAGCAGCGCATGTCTCAGTATGA
GGCCGGTGGTCTCCTTCGTCCCTTGGAAGAGCATGAGTCCTCTTCTAGGGTCGCTCGCCGTGTGGCTCTCACAGC
TCCTCTCAGCCAAGATACCCCCGGGTCACCTTCATCTACCCCCCGCGTCACTGGCCAGTTTGATGGTGCAGAAGA
CGATATCAAGGAGGAAGATGAAGACGCCATCAATTCGGACCTGGATGATCCAGATGACCTCGTTGCCGATGACCA
TGACGCAGATGAATCGGAGGGCCAGGTCATGCTTTGCACATACGATAAAGTCCAGCGCGTGAAGAACAAGTGGAA
GTGCACTCTGAAGGATGGCATCTTGACCACTGGTGGCAAAGAGTAAGTCATCCCACTCTCCCACGTTATGCATAT
ACTAACCGAACTAGATACGTCTTCCACAAGGGCCAGGGTGAATTCGAATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail