Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g407.t1
Gene name
Locationscaffold_01:1034629..1036112
Strand-
Gene length (bp)1483
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12220 U1snRNP70_N U1 small nuclear ribonucleoprotein of 70kDa MW N terminal 9.0E-25 3 93
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.4E-15 104 177

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 70.96 42.92 99.00
5d_25C Five days - 25 degrees Celsius 111.58 67.92 155.24
7d_25C Seven days - 25 degrees Celsius 137.33 83.67 190.99
10d_25C Ten days - 25 degrees Celsius 238.87 142.80 334.93
7d_15C Seven days - 15 degrees Celsius 99.49 60.50 138.48
7d_30C Seven days - 30 degrees Celsius 154.99 93.09 216.88

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.027278 yes
3d_25C 7d_25C 0.001278 yes
3d_25C 7d_15C 0.127072 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.397918 no
5d_25C 7d_15C 0.681488 no
5d_25C 7d_30C 0.139637 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.140401 no
7d_25C 7d_30C 0.665183 no
7d_25C 10d_25C 0.005626 yes
7d_15C 7d_30C 0.036077 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.038776 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g407.t1
MTDKLPPPLLALFQPRPPLRYLPPGDRAPDDCQKSTISGVAQFLADAKTFADEVPYNATESGVQRKLREKVEKKE
QLEKQIADGLQNYNPDKDPQARGDPFRTIFVSRLSYEAKEADLEREFGRFGPIERITIIKDTVSDKKKKPHRGYA
FVVFEREKDMKAAYKDTENFSIKGRPVVVDVERGRTTKGWKPRRLGGGLGGRGYTKVAQLPRGGPGFNAPSGPGG
YGGGFRGGFGGRGGGGGFRGGGFRGGNDRFGGPRGGIGYQGNRGGFGGQAPPNAPSGPGGGRSGGFRGGSFGGDR
GDRGGGAGGRFDRGATGSNSEPVRPRDSYADRDRRDYDRDDRYRDRDRDRMGDRGTGDRNGDRFRDRDRERGERG
DRYGGGGRDGGRDGGRDGGREDYGRKRNREDEPGHDDPRSRRRY*
Coding >Pro_DTO377G3_2|g407.t1
ATGACGGATAAGCTACCCCCGCCACTTCTGGCGCTGTTCCAGCCGCGTCCACCCCTTCGATATCTGCCTCCAGGC
GATCGCGCACCAGATGACTGCCAGAAGAGCACTATCTCTGGGGTTGCCCAGTTCCTTGCCGATGCTAAAACTTTT
GCCGATGAAGTTCCCTACAACGCAACTGAAAGCGGGGTGCAGCGCAAATTGCGCGAGAAAGTCGAGAAGAAAGAG
CAGTTAGAGAAGCAGATAGCGGATGGACTGCAAAACTACAATCCGGATAAAGATCCTCAAGCTCGAGGCGACCCA
TTCAGGACTATCTTTGTCTCACGCCTCAGTTATGAAGCCAAAGAAGCTGACCTGGAACGAGAGTTTGGCCGATTT
GGTCCCATTGAAAGAATTACCATCATCAAAGATACAGTATCAGACAAGAAAAAGAAACCCCACAGAGGCTATGCA
TTTGTCGTGTTCGAGCGCGAGAAGGATATGAAAGCGGCCTACAAAGACACAGAGAACTTCAGTATCAAGGGACGA
CCAGTTGTGGTAGATGTCGAGCGTGGCCGCACCACCAAGGGGTGGAAGCCCCGTCGCCTTGGTGGCGGTCTCGGA
GGGCGCGGATACACCAAGGTTGCGCAACTCCCCCGTGGTGGACCTGGTTTCAACGCACCATCTGGACCGGGTGGG
TATGGAGGCGGATTCCGCGGAGGCTTCGGGGGCAGAGGTGGAGGTGGTGGTTTCCGTGGTGGAGGTTTCCGCGGT
GGCAATGATCGCTTCGGTGGTCCTCGCGGTGGTATCGGATACCAGGGCAACCGTGGCGGCTTCGGTGGACAGGCT
CCCCCTAACGCGCCCTCCGGCCCTGGCGGTGGACGTAGCGGAGGTTTCAGAGGTGGTAGCTTCGGTGGTGATCGT
GGTGACCGCGGTGGTGGCGCCGGTGGCAGATTCGACCGTGGTGCAACTGGCAGCAATTCGGAGCCTGTGCGGCCT
CGAGATAGCTACGCTGACCGTGACCGCCGCGACTATGACCGTGACGACCGTTACAGAGATCGTGATCGTGACCGC
ATGGGAGATCGAGGCACTGGAGACCGAAACGGAGACCGATTCCGCGACCGGGACCGTGAACGTGGTGAACGTGGT
GACAGGTATGGCGGCGGTGGCCGTGATGGTGGTCGTGACGGCGGTCGTGACGGCGGCCGGGAGGATTATGGACGC
AAGCGAAACCGTGAGGATGAACCTGGACACGATGATCCTCGTTCCAGGAGAAGGTATTAA
Transcript >Pro_DTO377G3_2|g407.t1
ATGACGGATAAGCTACCCCCGCCACTTCTGGCGCTGTTCCAGCCGCGTCCACCCCTTCGATATCTGCCTCCAGGC
GATCGCGCACCAGATGACTGCCAGAAGAGCACTATCTCTGGGGTTGCCCAGTTCCTTGCCGATGCTAAAACTTTT
GCCGATGAAGTTCCCTACAACGCAACTGAAAGCGGGGTGCAGCGCAAATTGCGCGAGAAAGTCGAGAAGAAAGAG
CAGTTAGAGAAGCAGATAGCGGATGGACTGCAAAACTACAATCCGGATAAAGATCCTCAAGCTCGAGGCGACCCA
TTCAGGACTATCTTTGTCTCACGCCTCAGTTATGAAGCCAAAGAAGCTGACCTGGAACGAGAGTTTGGCCGATTT
GGTCCCATTGAAAGAATTACCATCATCAAAGATACAGTATCAGACAAGAAAAAGAAACCCCACAGAGGCTATGCA
TTTGTCGTGTTCGAGCGCGAGAAGGATATGAAAGCGGCCTACAAAGACACAGAGAACTTCAGTATCAAGGGACGA
CCAGTTGTGGTAGATGTCGAGCGTGGCCGCACCACCAAGGGGTGGAAGCCCCGTCGCCTTGGTGGCGGTCTCGGA
GGGCGCGGATACACCAAGGTTGCGCAACTCCCCCGTGGTGGACCTGGTTTCAACGCACCATCTGGACCGGGTGGG
TATGGAGGCGGATTCCGCGGAGGCTTCGGGGGCAGAGGTGGAGGTGGTGGTTTCCGTGGTGGAGGTTTCCGCGGT
GGCAATGATCGCTTCGGTGGTCCTCGCGGTGGTATCGGATACCAGGGCAACCGTGGCGGCTTCGGTGGACAGGCT
CCCCCTAACGCGCCCTCCGGCCCTGGCGGTGGACGTAGCGGAGGTTTCAGAGGTGGTAGCTTCGGTGGTGATCGT
GGTGACCGCGGTGGTGGCGCCGGTGGCAGATTCGACCGTGGTGCAACTGGCAGCAATTCGGAGCCTGTGCGGCCT
CGAGATAGCTACGCTGACCGTGACCGCCGCGACTATGACCGTGACGACCGTTACAGAGATCGTGATCGTGACCGC
ATGGGAGATCGAGGCACTGGAGACCGAAACGGAGACCGATTCCGCGACCGGGACCGTGAACGTGGTGAACGTGGT
GACAGGTATGGCGGCGGTGGCCGTGATGGTGGTCGTGACGGCGGTCGTGACGGCGGCCGGGAGGATTATGGACGC
AAGCGAAACCGTGAGGATGAACCTGGACACGATGATCCTCGTTCCAGGAGAAGGTATTAA
Gene >Pro_DTO377G3_2|g407.t1
ATGACGGATAAGCTACCCCCGCCACTTCTGGCGCTGTTCCAGCCGCGTCCACCCCTTCGATATCTGCCTCCAGGC
GATCGCGCACCAGATGACTGCCAGAAGAGCACTATCTCTGGGGTTGCCCAGTTCCTTGCCGATGCTAAAACTTTT
GCCGATGAAGTTCCCTACAACGCAACTGAAAGCGGGGTGCAGCGCAAATTGCGCGAGAAAGTCGAGAAGAAAGAG
CAGTTAGAGAAGCAGATAGCGGATGGACTGCAAAACTGTACGCTTTATCCTCTTTTCACATTTCACATTATTTCA
AGAGGCTAACGTGGCTATGTCTTACAGACAATCCGGATAAAGATCCTCAAGCTCGAGGCGACCCATTCAGGACTA
TCTTTGTCTCACGCCTCAGTTATGAAGCCAAAGAAGCTGACCTGGAACGAGAGTTTGGCCGATTTGGTCCCATTG
AAAGAGTATGTCTTGTTTTCCTTATCCCTTGTGAATATAAACAGCTCTAACTTTGTGATTCCAGATTACCATCAT
CAAAGATACAGTATCAGACAAGAAAAAGAAACCCCACAGAGGCTATGCATTTGTCGTGTTCGAGCGCGAGAAGGA
TATGAAAGGTATCACAACCATGGCAATTTACTTGGCATCCAACCCACCCGTTTAATTCGTCTTGCGGTAAGAAAT
GTTGCTGACCCCAGTTCCTTCATCAATATCAGCGGCCTACAAAGACACAGAGAACTTCAGTATCAAGGGACGACC
AGTTGTGGTAGATGTCGAGCGTGGCCGCACCACCAAGGGGTGGAAGCCCCGTCGCCTTGGTGGCGGTCTCGGAGG
GCGCGGATACACCAAGGTTGCGCAACTCCCCCGTGGTGGACCTGGTTTCAACGCACCATCTGGACCGGGTGGGTA
TGGAGGCGGATTCCGCGGAGGCTTCGGGGGCAGAGGTGGAGGTGGTGGTTTCCGTGGTGGAGGTTTCCGCGGTGG
CAATGATCGCTTCGGTGGTCCTCGCGGTGGTATCGGATACCAGGGCAACCGTGGCGGCTTCGGTGGACAGGCTCC
CCCTAACGCGCCCTCCGGCCCTGGCGGTGGACGTAGCGGAGGTTTCAGAGGTGGTAGCTTCGGTGGTGATCGTGG
TGACCGCGGTGGTGGCGCCGGTGGCAGATTCGACCGTGGTGCAACTGGCAGCAATTCGGAGCCTGTGCGGCCTCG
AGATAGCTACGCTGACCGTGACCGCCGCGACTATGACCGTGACGACCGTTACAGAGATCGTGATCGTGACCGCAT
GGGAGATCGAGGCACTGGAGACCGAAACGGAGACCGATTCCGCGACCGGGACCGTGAACGTGGTGAACGTGGTGA
CAGGTATGGCGGCGGTGGCCGTGATGGTGGTCGTGACGGCGGTCGTGACGGCGGCCGGGAGGATTATGGACGCAA
GCGAAACCGTGAGGATGAACCTGGACACGATGATCCTCGTTCCAGGAGAAGGTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail