Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4063.t1
Gene name
Locationscaffold_07:710148..711698
Strand-
Gene length (bp)1550
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06423 GWT1 GWT1 7.9E-39 304 456

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0016746 transferase activity, transferring acyl groups Yes
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0036211 protein modification process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006497 protein lipidation No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0009247 glycolipid biosynthetic process No
GO:0016740 transferase activity No
GO:0006505 GPI anchor metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006464 cellular protein modification process No
GO:0008610 lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0046486 glycerolipid metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0019538 protein metabolic process No
GO:0044425 membrane part No
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0044267 cellular protein metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0006643 membrane lipid metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0005575 cellular_component No
GO:0045017 glycerolipid biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 49 71 22
3 78 95 17
4 132 154 22
5 167 189 22
6 204 226 22
7 239 258 19
8 308 330 22
9 351 373 22
10 388 410 22
11 440 459 19
12 469 486 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4063.t1
MDPSYKARKEAFVSNLAGSTILEINAVTLVASTSVLLWSALQSRLSFFTPYSPAALATDFILNVLAILFATTAYS
SAPLLLNIFLISPAVLLFLTRNGLRTPQKAKPPRKPKAKNESSQEEQQALPIHPFLTTYRAAMMVVTCIAILAVD
FRAFPRRFAKVENWGTSLMDLGVGSFVFSAGVVSARAVLKGRDSKSPKLALHKRLIGSARHSIPLLVLGLIRLWS
VKGLDYAEHVTEYGVHWNFFFTLGFLPPFVELFDSLTTLIPSYEVLALGIAVLYQVTLESTDLKGYILVSPRGPD
LLSKNREGVFSFIGYFAIFLAGRGVGVRIIPRGTSATISPQQARSSVLVCLVLQGMFWSTMFFFNSTYAFGYGAN
IPVSRRLANMPYVLWVSAFNSAQLFLFCLTETVFFPAVHRATSKESESEQTSFATSRILHAFNRGGLALFLIANL
LTGAVNLTIPTLDLNTPQAMGILIVYAAVLTGAALGMDKYNIKLSL*
Coding >Pro_DTO377G3_2|g4063.t1
ATGGATCCGAGCTACAAAGCTCGCAAGGAGGCTTTTGTGTCTAATCTTGCGGGAAGCACAATCCTCGAGATCAAT
GCAGTGACACTCGTTGCATCAACTTCTGTCCTCCTTTGGTCAGCGCTCCAGTCTCGTCTATCCTTCTTCACGCCC
TACAGTCCTGCAGCGCTCGCGACCGACTTCATCCTCAATGTACTAGCCATCTTATTCGCAACGACTGCATACTCC
TCCGCACCGCTTCTCCTCAACATCTTCCTCATCTCCCCCGCGGTCCTCCTATTCCTCACCCGAAACGGCCTGCGA
ACACCCCAAAAAGCCAAACCTCCCCGCAAACCCAAGGCCAAAAATGAGAGCTCCCAGGAGGAGCAGCAGGCTTTG
CCCATTCACCCATTCTTGACCACGTACCGTGCGGCCATGATGGTTGTCACCTGCATAGCTATTCTCGCAGTCGAC
TTCCGCGCGTTTCCACGTCGTTTTGCCAAGGTAGAGAACTGGGGAACATCTTTGATGGACTTGGGTGTGGGCTCT
TTTGTGTTCTCGGCTGGAGTAGTCTCTGCGCGTGCGGTTTTGAAGGGCCGGGACTCGAAATCCCCAAAATTAGCT
TTGCATAAGAGATTGATTGGGTCGGCTCGGCACTCCATTCCTCTGCTTGTGCTAGGCCTCATCCGACTGTGGAGT
GTGAAAGGATTGGACTACGCGGAACATGTGACGGAATATGGTGTACACTGGAACTTTTTCTTCACGCTTGGCTTT
TTGCCTCCTTTCGTGGAGCTATTCGACTCCTTGACTACATTGATTCCCTCGTATGAGGTACTTGCACTTGGAATT
GCAGTACTCTACCAAGTCACTCTGGAGTCGACTGATCTCAAGGGTTACATTCTTGTGTCTCCTCGGGGACCAGAT
CTACTCTCCAAGAACCGAGAGGGAGTCTTTTCTTTCATCGGATATTTTGCAATCTTCCTCGCTGGACGGGGTGTT
GGAGTCCGCATCATTCCTCGTGGTACCTCGGCCACAATATCGCCTCAGCAGGCACGGAGCTCTGTTCTGGTGTGC
TTGGTTCTGCAGGGAATGTTCTGGTCTACCATGTTCTTCTTCAATTCCACCTACGCGTTTGGCTATGGTGCCAAC
ATCCCAGTGTCGCGCCGGCTGGCTAACATGCCGTATGTGCTTTGGGTGTCAGCATTCAACAGCGCCCAGCTTTTC
CTGTTCTGTCTGACAGAGACTGTGTTTTTCCCCGCGGTCCACCGTGCGACTAGCAAGGAAAGCGAATCAGAGCAG
ACGTCATTTGCGACCAGTCGGATTTTACATGCCTTCAACCGCGGTGGCCTTGCATTGTTCCTGATTGCGAACCTG
CTCACTGGAGCAGTGAACCTGACCATTCCAACATTGGATCTCAACACGCCGCAAGCCATGGGCATTCTAATTGTC
TATGCGGCGGTGTTAACTGGTGCTGCTTTGGGGATGGACAAGTACAATATTAAGTTGAGCTTGTAG
Transcript >Pro_DTO377G3_2|g4063.t1
ATGGATCCGAGCTACAAAGCTCGCAAGGAGGCTTTTGTGTCTAATCTTGCGGGAAGCACAATCCTCGAGATCAAT
GCAGTGACACTCGTTGCATCAACTTCTGTCCTCCTTTGGTCAGCGCTCCAGTCTCGTCTATCCTTCTTCACGCCC
TACAGTCCTGCAGCGCTCGCGACCGACTTCATCCTCAATGTACTAGCCATCTTATTCGCAACGACTGCATACTCC
TCCGCACCGCTTCTCCTCAACATCTTCCTCATCTCCCCCGCGGTCCTCCTATTCCTCACCCGAAACGGCCTGCGA
ACACCCCAAAAAGCCAAACCTCCCCGCAAACCCAAGGCCAAAAATGAGAGCTCCCAGGAGGAGCAGCAGGCTTTG
CCCATTCACCCATTCTTGACCACGTACCGTGCGGCCATGATGGTTGTCACCTGCATAGCTATTCTCGCAGTCGAC
TTCCGCGCGTTTCCACGTCGTTTTGCCAAGGTAGAGAACTGGGGAACATCTTTGATGGACTTGGGTGTGGGCTCT
TTTGTGTTCTCGGCTGGAGTAGTCTCTGCGCGTGCGGTTTTGAAGGGCCGGGACTCGAAATCCCCAAAATTAGCT
TTGCATAAGAGATTGATTGGGTCGGCTCGGCACTCCATTCCTCTGCTTGTGCTAGGCCTCATCCGACTGTGGAGT
GTGAAAGGATTGGACTACGCGGAACATGTGACGGAATATGGTGTACACTGGAACTTTTTCTTCACGCTTGGCTTT
TTGCCTCCTTTCGTGGAGCTATTCGACTCCTTGACTACATTGATTCCCTCGTATGAGGTACTTGCACTTGGAATT
GCAGTACTCTACCAAGTCACTCTGGAGTCGACTGATCTCAAGGGTTACATTCTTGTGTCTCCTCGGGGACCAGAT
CTACTCTCCAAGAACCGAGAGGGAGTCTTTTCTTTCATCGGATATTTTGCAATCTTCCTCGCTGGACGGGGTGTT
GGAGTCCGCATCATTCCTCGTGGTACCTCGGCCACAATATCGCCTCAGCAGGCACGGAGCTCTGTTCTGGTGTGC
TTGGTTCTGCAGGGAATGTTCTGGTCTACCATGTTCTTCTTCAATTCCACCTACGCGTTTGGCTATGGTGCCAAC
ATCCCAGTGTCGCGCCGGCTGGCTAACATGCCGTATGTGCTTTGGGTGTCAGCATTCAACAGCGCCCAGCTTTTC
CTGTTCTGTCTGACAGAGACTGTGTTTTTCCCCGCGGTCCACCGTGCGACTAGCAAGGAAAGCGAATCAGAGCAG
ACGTCATTTGCGACCAGTCGGATTTTACATGCCTTCAACCGCGGTGGCCTTGCATTGTTCCTGATTGCGAACCTG
CTCACTGGAGCAGTGAACCTGACCATTCCAACATTGGATCTCAACACGCCGCAAGCCATGGGCATTCTAATTGTC
TATGCGGCGGTGTTAACTGGTGCTGCTTTGGGGATGGACAAGTACAATATTAAGTTGAGCTTGTAG
Gene >Pro_DTO377G3_2|g4063.t1
ATGGATCCGAGCTACAAAGCTCGCAAGGAGGCTTTTGTGTCTAATCTTGCGGGAAGCACAATCCTCGAGATCAAT
GCAGTGACACTCGTTGCATCAGTGAGAAACCTCAAGACTTTATCTTGCAATTTATACATTCTGACCTGTGACCAC
TCTAGACTTCTGTCCTCCTTTGGTCAGCGCTCCAGTCTCGTCTATCCTTCTTCACGCCCTACAGTCCTGCAGCGC
TCGCGACCGACTTCATCCTCAATGTACTAGCCATCTTATTCGCAACGACTGCATACTCCTCCGCACCGCTTCTCC
TCAACATCTTCCTCATCTCCCCCGCGGTCCTCCTATTCCTCACCCGAAACGGCCTGCGAACACCCCAAAAAGCCA
AACCTCCCCGCAAACCCAAGGCCAAAAATGAGAGCTCCCAGGAGGAGCAGCAGGCTTTGCCCATTCACCCATTCT
TGACCACGTACCGTGCGGCCATGATGGTTGTCACCTGCATAGCTATTCTCGCAGTCGACTTCCGCGCGTTTCCAC
GTCGTTTTGCCAAGGTAGAGAACTGGGGAACATCTTTGATGGACTTGGGTGTGGGCTCTTTTGTGTTCTCGGCTG
GAGTAGTCTCTGCGCGTGCGGTTTTGAAGGGCCGGGACTCGAAATCCCCAAAATTAGCTTTGCATAAGAGATTGA
TTGGGTCGGCTCGGCACTCCATTCCTCTGCTTGTGCTAGGCCTCATCCGACTGTGGAGTGTGAAAGGATTGGACT
ACGCGGAACATGTGACGGAATATGGTGTACACTGGAACTTTTTCTTCACGCTTGGCTTTTTGCCTCCTTTCGTGG
AGCTATTCGACTCCTTGACTACATTGATTCCCTCGTATGAGGTACTTGCACTTGGAATTGCAGTACTCTACCAAG
TCACTCTGGAGTCGACTGATCTCAAGGGTTACATTCTTGTGTCTCCTCGGGGACCAGATCTACTCTCCAAGAACC
GAGAGGGAGTCTTTTCTTTCATCGGATATTTTGCAATCTTCCTCGCTGGACGGGGTGTTGGAGTCCGCATCATTC
CTCGTGGTACCTCGGCCACAATATCGCCTCAGCAGGCACGGAGCTCTGTTCTGGTGTGCTTGGTTCTGCAGGGAA
TGTTCTGGTCTACCATGTTCTTCTTCAATTCCACCTACGCGTTTGGCTATGGTGCCAACATCCCAGTGTCGCGCC
GGCTGGCTAACATGCCGTATGTGCTTTGGGTGTCAGCATTCAACAGCGCCCAGCTTTTCCTGTTCTGTCTGACAG
AGACTGTGTTTTTCCCCGCGGTCCACCGTGCGACTAGCAAGGAAAGCGAATCAGAGCAGACGTCATTTGCGACCA
GTCGGATTTTACATGCCTTCAACCGCGGTGGCCTTGCATTGTTCCTGATTGCGAACCTGCTCACTGGAGCAGTGA
ACCTGACCATTCCAACATTGGATCTCAACACGCCGCAAGCCATGGGCATTCTAATTGTCTATGCGGCGGTGTTAA
CTGGTGCTGCTTTGGGGATGGACAAGTACAATATTAAGTTGAGCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail