Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4033.t1
Gene name
Locationscaffold_07:594516..596287
Strand+
Gene length (bp)1771
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.2E-54 86 412
PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain 2.2E-30 435 550
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.8E-14 257 317
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.6E-08 216 396

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0045454 cell redox homeostasis Yes
GO:0065008 regulation of biological quality No
GO:0008150 biological_process No
GO:0019725 cellular homeostasis No
GO:0042592 homeostatic process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0065007 biological regulation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 176.11 106.10 246.12
5d_25C Five days - 25 degrees Celsius 152.57 92.61 212.52
7d_25C Seven days - 25 degrees Celsius 127.83 78.12 177.55
10d_25C Ten days - 25 degrees Celsius 128.79 78.66 178.91
7d_15C Seven days - 15 degrees Celsius 148.68 90.12 207.23
7d_30C Seven days - 30 degrees Celsius 118.10 71.91 164.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.590506 no
3d_25C 7d_25C 0.142592 no
3d_25C 7d_15C 0.510718 no
3d_25C 7d_30C 0.056162 no
3d_25C 10d_25C 0.157946 no
5d_25C 7d_25C 0.485336 no
5d_25C 7d_15C 0.938728 no
5d_25C 7d_30C 0.265168 no
5d_25C 10d_25C 0.509965 no
7d_25C 7d_15C 0.564268 no
7d_25C 7d_30C 0.793709 no
7d_25C 10d_25C 0.984207 no
7d_15C 7d_30C 0.331718 no
7d_15C 10d_25C 0.591597 no
7d_30C 10d_25C 0.768260 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4033.t1
MLSRSIQSSRISFRASSSLTRSSVGQIRPGRLTNRTLATINSTRFTPANPIATNSRLSTISRHFSSSSAPENQQP
SNMAPVETHQYDYIVLGGGSGGSGSARRAAGWYGKKTLIVESGRSGGTCVNVGCVPKKMTWNFATINETLHIAKN
YGYDIPNNVSMNYTHFKNTRDAVIKRLNGAYEGNWGREGIDLVQGRAGFVEPHTIEVKLADGSGTARYTAPHILL
ATGGRPSVPAVPGAEHGITSDGFFELEELPPKIAVVGAGYIAVELAGVLNAVDVETHMFIRGETFLRKFDPMIQK
TMTDRYEAAGVKLHRSHGGFKEVQLIRDGKGKDRLLKLIGHDGSEIEVNELLWAVGRAPEIEDLNLDIPGVKLNL
GNHVLVDEYQNTSVEGIYALGDVTGQAELTPVAIAAGRQLGSRLFGPVELKHSKISYENIPTVVFSHPEVGCVGL
TEPEARIRYGDDKIKVYHTKFTAMFYDVGLSPEEKAKNPTEMKIICAGPQEKVVGLHILGLGVGEMLQGFGVAIK
MGATKQDFDSCVAIHPTSAEELVTMR*
Coding >Pro_DTO377G3_2|g4033.t1
ATGCTCTCCCGCTCCATCCAATCCTCCCGAATTAGCTTTCGAGCCTCTTCATCTCTGACCCGATCTTCTGTCGGA
CAAATTCGTCCTGGTCGTTTGACCAATCGAACTCTGGCGACCATCAACTCTACTCGCTTCACCCCTGCGAACCCA
ATTGCTACGAACTCTCGGCTCTCTACAATCTCTCGACACTTTTCTTCGTCATCCGCCCCTGAGAACCAACAACCA
TCCAATATGGCTCCCGTCGAAACACATCAGTATGACTACATCGTCCTCGGCGGTGGTAGTGGTGGCAGTGGAAGC
GCTCGCCGCGCAGCTGGTTGGTATGGCAAGAAGACCCTCATCGTGGAAAGCGGGCGGTCTGGCGGTACCTGTGTC
AATGTGGGATGTGTCCCTAAGAAGATGACATGGAACTTTGCGACCATCAATGAGACGTTGCACATCGCAAAGAAC
TATGGCTACGACATCCCCAATAACGTTTCTATGAACTACACCCACTTTAAGAACACCCGCGATGCCGTCATTAAA
CGGTTGAACGGCGCCTACGAGGGCAACTGGGGTCGCGAGGGAATCGACCTGGTCCAAGGCCGTGCTGGCTTCGTC
GAGCCTCACACTATCGAGGTCAAGCTGGCCGACGGCTCCGGTACTGCCCGTTACACCGCACCCCACATCTTGTTG
GCTACCGGTGGCCGGCCTAGCGTCCCCGCCGTACCCGGCGCCGAGCACGGTATCACAAGCGACGGATTCTTCGAG
TTGGAAGAGCTTCCCCCTAAGATCGCCGTTGTCGGTGCTGGCTACATCGCCGTTGAGCTTGCTGGTGTCCTGAAC
GCTGTTGATGTTGAGACCCACATGTTCATCCGCGGCGAGACCTTCTTGCGCAAGTTCGACCCTATGATCCAGAAG
ACTATGACTGATCGCTACGAGGCCGCCGGCGTCAAGCTTCACCGCAGCCACGGTGGTTTCAAGGAGGTGCAACTC
ATTCGGGATGGCAAGGGCAAGGATCGCCTGCTCAAGCTCATTGGCCACGATGGCTCTGAGATCGAGGTCAACGAG
CTCCTCTGGGCTGTGGGCCGTGCCCCCGAGATCGAAGACCTAAACTTGGATATCCCTGGTGTCAAGCTGAATCTT
GGGAATCACGTCTTGGTTGACGAGTACCAGAACACCTCCGTTGAGGGTATCTACGCTCTCGGTGACGTGACCGGT
CAAGCTGAGTTGACCCCTGTTGCCATTGCTGCCGGTCGCCAACTCGGCAGCCGTCTCTTCGGCCCTGTCGAGCTG
AAGCACTCCAAGATCTCCTACGAGAACATTCCTACGGTCGTTTTCTCGCACCCCGAGGTCGGCTGCGTCGGTCTC
ACCGAGCCCGAGGCCCGCATTCGCTACGGCGACGACAAGATTAAGGTTTATCACACCAAGTTCACTGCCATGTTC
TACGATGTCGGCTTGTCCCCAGAGGAGAAGGCCAAGAACCCCACCGAGATGAAGATCATTTGCGCCGGTCCCCAG
GAAAAGGTTGTCGGTCTGCACATCCTTGGTCTTGGCGTCGGTGAGATGCTGCAGGGCTTCGGTGTTGCTATCAAG
ATGGGTGCTACTAAGCAGGACTTCGATAGCTGTGTTGCTATCCACCCTACTAGCGCCGAGGAGCTTGTGACCATG
CGGTAA
Transcript >Pro_DTO377G3_2|g4033.t1
ATGCTCTCCCGCTCCATCCAATCCTCCCGAATTAGCTTTCGAGCCTCTTCATCTCTGACCCGATCTTCTGTCGGA
CAAATTCGTCCTGGTCGTTTGACCAATCGAACTCTGGCGACCATCAACTCTACTCGCTTCACCCCTGCGAACCCA
ATTGCTACGAACTCTCGGCTCTCTACAATCTCTCGACACTTTTCTTCGTCATCCGCCCCTGAGAACCAACAACCA
TCCAATATGGCTCCCGTCGAAACACATCAGTATGACTACATCGTCCTCGGCGGTGGTAGTGGTGGCAGTGGAAGC
GCTCGCCGCGCAGCTGGTTGGTATGGCAAGAAGACCCTCATCGTGGAAAGCGGGCGGTCTGGCGGTACCTGTGTC
AATGTGGGATGTGTCCCTAAGAAGATGACATGGAACTTTGCGACCATCAATGAGACGTTGCACATCGCAAAGAAC
TATGGCTACGACATCCCCAATAACGTTTCTATGAACTACACCCACTTTAAGAACACCCGCGATGCCGTCATTAAA
CGGTTGAACGGCGCCTACGAGGGCAACTGGGGTCGCGAGGGAATCGACCTGGTCCAAGGCCGTGCTGGCTTCGTC
GAGCCTCACACTATCGAGGTCAAGCTGGCCGACGGCTCCGGTACTGCCCGTTACACCGCACCCCACATCTTGTTG
GCTACCGGTGGCCGGCCTAGCGTCCCCGCCGTACCCGGCGCCGAGCACGGTATCACAAGCGACGGATTCTTCGAG
TTGGAAGAGCTTCCCCCTAAGATCGCCGTTGTCGGTGCTGGCTACATCGCCGTTGAGCTTGCTGGTGTCCTGAAC
GCTGTTGATGTTGAGACCCACATGTTCATCCGCGGCGAGACCTTCTTGCGCAAGTTCGACCCTATGATCCAGAAG
ACTATGACTGATCGCTACGAGGCCGCCGGCGTCAAGCTTCACCGCAGCCACGGTGGTTTCAAGGAGGTGCAACTC
ATTCGGGATGGCAAGGGCAAGGATCGCCTGCTCAAGCTCATTGGCCACGATGGCTCTGAGATCGAGGTCAACGAG
CTCCTCTGGGCTGTGGGCCGTGCCCCCGAGATCGAAGACCTAAACTTGGATATCCCTGGTGTCAAGCTGAATCTT
GGGAATCACGTCTTGGTTGACGAGTACCAGAACACCTCCGTTGAGGGTATCTACGCTCTCGGTGACGTGACCGGT
CAAGCTGAGTTGACCCCTGTTGCCATTGCTGCCGGTCGCCAACTCGGCAGCCGTCTCTTCGGCCCTGTCGAGCTG
AAGCACTCCAAGATCTCCTACGAGAACATTCCTACGGTCGTTTTCTCGCACCCCGAGGTCGGCTGCGTCGGTCTC
ACCGAGCCCGAGGCCCGCATTCGCTACGGCGACGACAAGATTAAGGTTTATCACACCAAGTTCACTGCCATGTTC
TACGATGTCGGCTTGTCCCCAGAGGAGAAGGCCAAGAACCCCACCGAGATGAAGATCATTTGCGCCGGTCCCCAG
GAAAAGGTTGTCGGTCTGCACATCCTTGGTCTTGGCGTCGGTGAGATGCTGCAGGGCTTCGGTGTTGCTATCAAG
ATGGGTGCTACTAAGCAGGACTTCGATAGCTGTGTTGCTATCCACCCTACTAGCGCCGAGGAGCTTGTGACCATG
CGGTAA
Gene >Pro_DTO377G3_2|g4033.t1
ATGCTCTCCCGCTCCATCCAATCCTCCCGAATTAGCTTTCGAGCCTCTTCATCTCTGACCCGATCTTCTGTCGGA
CAAATTCGTCCTGGTCGTTTGACCAATCGAACTCTGGCGACCATCAACTCTACTCGCTTCACCCCTGCGAACCCA
ATTGCTACGAACTCTCGGCTCTCTACAATCTCTCGACACTTTTCTTCGTCATCCGCCCCTGAGAACCAACAACCA
TCCAATATGGCTCCCGTCGAAACACATCAGTATGACTACATCGTCCTCGGCGGTGGTAGTGGTGGCAGTGGAAGC
GCTCGCCGCGCAGCTGGTTGGTATGGCAAGAAGACCCTCATCGTGGAAAGCGGGCGGTCTGGCGGTACCTGTGTC
AATGTGGGGTGAGTACAAGGTGTAATGCCGTTCTACTCGATTGACGGTTTTTTTCTGACGACATTCAGATGTGTC
CCTAAGAAGATGACATGGAACTTTGCGACCATCAATGAGACGTTGCACATCGCAAAGAACTATGGCTACGACATC
CCCAATAACGTTTCTATGAACTACACCCACTTTAAGAACACCCGCGATGCCGTCATTAAACGGTTGAACGGCGCC
TACGAGGGCAACTGGGGTCGCGAGGGAATCGACCTGGTCCAAGGCCGTGCTGGCTTCGTCGAGCCTCACACTATC
GAGGTCAAGCTGGCCGACGGCTCCGGTACTGCCCGTTACACCGCACCCCACATCTTGTTGGCTACCGGTGGCCGG
CCTAGCGTCCCCGCCGTACCCGGCGCCGAGCACGGTATCACAAGCGACGGATTCTTCGAGTTGGAAGAGCTTCCC
CCTAAGATCGCCGTTGTCGGTGCTGGCTACATCGCCGTTGAGCTTGCTGGTGTCCTGAACGCTGTTGATGTTGAG
ACCCACATGTTCATCCGCGGCGAGACCTTCTTGCGCAAGTTCGACCCTATGATCCAGAAGACTATGACTGATCGC
TACGAGGCCGCCGGCGTCAAGCTTCACCGCAGCCACGGTGGTTTCAAGGAGGTGCAACTCATTCGGGATGGCAAG
GGCAAGGATCGCCTGCTCAAGCTCATTGGCCACGATGGCTCTGAGATCGAGGTCAACGAGCTCCTCTGGGCTGTG
GGCCGTGCCCCCGAGATCGAAGACCTAAACTTGGATATCCCTGGTGTCAAGCTGAATCTTGGGAATCACGTCTTG
GTTGACGAGTACCAGAACACCTCCGTTGAGGGTATCTACGCTCTCGGTGACGTGACCGGTCAAGCTGAGTTGACC
CCTGGTAAGTCGTTATCCCCACTTTTCGTCCGAATAAATGCACTGACTGTGTTCTGTAGTTGCCATTGCTGCCGG
TCGCCAACTCGGCAGCCGTCTCTTCGGCCCTGTCGAGCTGAAGCACTCCAAGATCTCCTACGAGAACATTCCTAC
GGTCGTTTTCTCGCACCCCGAGGTCGGCTGCGTCGGTCTCACCGAGCCCGAGGCCCGCATTCGCTACGGCGACGA
CAAGATTAAGGTTTATCACACCAAGTTCACTGCCATGTTCTACGATGTCGGCTTGTCCCCAGAGGAGAAGGCCAA
GAACCCCACCGAGATGAAGATCATTTGCGCCGGTCCCCAGGAAAAGGTTGTCGGTCTGCACATCCTTGGTCTTGG
CGTCGGTGAGATGCTGCAGGGCTTCGGTGTTGCTATCAAGATGGGTGCTACTAAGCAGGACTTCGATAGCTGTGT
TGCTATCCACCCTACTAGCGCCGAGGAGCTTGTGACCATGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail