Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4022.t1
Gene name
Locationscaffold_07:559353..561724
Strand+
Gene length (bp)2371
Transcript length (bp)2088
Coding sequence length (bp)2088
Protein length (aa) 696

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 9.9E-16 105 173
PF02889 Sec63 Sec63 Brl domain 6.6E-06 243 413

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 76 98 22
3 204 226 22
4 341 363 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 83.01 50.92 115.10
5d_25C Five days - 25 degrees Celsius 64.24 39.37 89.11
7d_25C Seven days - 25 degrees Celsius 60.80 37.24 84.37
10d_25C Ten days - 25 degrees Celsius 68.23 41.84 94.63
7d_15C Seven days - 15 degrees Celsius 65.32 39.05 91.59
7d_30C Seven days - 30 degrees Celsius 78.93 46.93 110.93

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.247343 no
3d_25C 7d_25C 0.142592 no
3d_25C 7d_15C 0.306777 no
3d_25C 7d_30C 0.875183 no
3d_25C 10d_25C 0.411607 no
5d_25C 7d_25C 0.857821 no
5d_25C 7d_15C 0.963183 no
5d_25C 7d_30C 0.404380 no
5d_25C 10d_25C 0.842175 no
7d_25C 7d_15C 0.814062 no
7d_25C 7d_30C 0.261251 no
7d_25C 10d_25C 0.664428 no
7d_15C 7d_30C 0.465218 no
7d_15C 10d_25C 0.891120 no
7d_30C 10d_25C 0.585556 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4022.t1
MSSDYTYDEQGQFFPFFILTLTGLVTLPLTYNLLRPSKELENTAPRIKSDFKPKDADLIDAQKRKRLRKERRIKR
IITVVVGYAVMAWMVYLIVVTARTVVKAYDPYDILGVSRNADEKAISRHYKRMSLIFHPDKIRPDPSKNETIEML
NERFVELTKAYKALTDEEVRNNYLQFGHPDGKQSFSIGIALPKFIIMDGNGKYVLMVYGALLGVLLPYIVGKWWY
GSQRYTKERVLVASAGNIFREYKDDITEGGIISALSSGEEFNDMLKGARAESGLNKLEKRVLADDNSFLTPKDRD
TLKQLDSSSRRKALALLWAYLGRIDLGDASLDAEKYEAAPVALALTEAFTAISLAFGNLGPIVGAFKTSQNLIQA
VSPGSSPLLQLPNFTEAIVKSVEGEDAKEHLTVQRYMELPEAQRRSLTVGAGLLSDKQYTDAVSVAKQLPLLQPE
RIFFKVMGEKVITPSSLVQLVVKARFIPPGSTSVPPVNPLDLEDIDPDEDDLEALMGRKPAKNSATKMEDGKKVE
AKIESIQPPLANAPYLARDHSPRWNIFLADGKQGKMAVPPFTFTTFDKPIFDEAGKPTFNVQTLKMQFQAPPQVG
DFSFLLHMICDSYLGLDNTAQIILHIDDPAKAAAVQEEDDISEPDEDSIAGQMQAIKTGQAPKKKTKDSDDSSES
DTDGDAGDTSDTNTETEDED*
Coding >Pro_DTO377G3_2|g4022.t1
ATGTCGTCAGACTACACCTATGATGAGCAGGGACAATTCTTCCCCTTCTTCATCCTCACCTTGACCGGCCTGGTC
ACTCTCCCTCTCACCTATAACCTCCTACGACCCAGCAAAGAGCTTGAGAATACCGCTCCCCGCATCAAATCCGAT
TTCAAACCTAAAGATGCGGACCTCATTGACGCGCAGAAGCGCAAGCGTCTCCGAAAAGAGCGCCGAATCAAGCGC
ATTATTACCGTCGTCGTCGGCTATGCCGTAATGGCATGGATGGTCTACTTAATTGTCGTCACCGCTAGGACAGTG
GTGAAGGCATACGACCCTTATGATATTTTGGGTGTCTCGAGGAACGCCGATGAAAAAGCTATCTCCAGACATTAC
AAGCGCATGTCTTTGATCTTTCACCCCGATAAAATTCGTCCTGACCCCTCTAAGAATGAGACCATCGAGATGCTC
AACGAGCGTTTCGTGGAGCTCACCAAGGCATATAAAGCTCTCACCGATGAGGAGGTGCGAAACAACTACCTCCAA
TTTGGCCACCCCGACGGAAAGCAGAGCTTTAGTATCGGTATTGCCCTTCCCAAGTTCATTATCATGGATGGCAAT
GGCAAATATGTTCTGATGGTCTATGGTGCCCTTTTGGGTGTTCTTCTACCATATATCGTCGGCAAGTGGTGGTAT
GGATCTCAGCGCTACACAAAGGAGCGCGTTCTTGTCGCCAGTGCCGGAAACATTTTCCGTGAGTACAAGGACGAT
ATTACCGAAGGTGGGATTATTAGCGCTTTGTCGTCTGGCGAGGAATTCAACGATATGCTCAAGGGTGCCCGGGCC
GAGTCTGGCCTGAACAAGCTCGAGAAGCGGGTGCTGGCAGATGATAATTCGTTCCTTACGCCCAAGGACCGTGAT
ACCCTGAAGCAATTGGATAGCTCCTCTCGTCGGAAGGCCTTGGCTTTGTTATGGGCTTATCTTGGGCGAATTGAT
CTTGGTGATGCTTCTCTGGATGCTGAAAAGTATGAAGCGGCTCCTGTCGCCCTTGCTCTCACTGAAGCTTTCACT
GCTATTTCACTCGCATTTGGTAATCTCGGACCGATCGTCGGTGCCTTCAAAACGTCTCAGAACCTCATCCAGGCT
GTGTCCCCGGGCTCATCACCACTGCTGCAACTTCCCAACTTCACCGAGGCCATTGTCAAGTCCGTAGAGGGCGAA
GACGCCAAGGAACATCTCACCGTCCAAAGGTACATGGAACTACCAGAGGCTCAGCGACGCAGTCTTACTGTCGGC
GCTGGTCTTCTATCCGATAAGCAATACACCGACGCCGTATCAGTTGCCAAGCAACTTCCCTTGCTTCAACCCGAG
CGGATCTTCTTTAAGGTTATGGGAGAAAAGGTGATCACACCCAGCAGTCTGGTACAGCTGGTAGTCAAAGCCCGC
TTCATCCCGCCAGGCAGCACATCCGTGCCGCCAGTGAACCCGCTCGACCTAGAGGACATTGACCCCGACGAGGAC
GACCTGGAAGCCCTGATGGGTCGCAAGCCAGCCAAGAACAGCGCCACTAAGATGGAGGACGGTAAGAAGGTTGAG
GCAAAGATTGAAAGCATCCAGCCGCCTCTGGCCAACGCACCGTACCTAGCGCGCGATCACTCCCCTCGCTGGAAC
ATCTTCCTAGCAGACGGCAAGCAGGGCAAGATGGCCGTACCGCCGTTCACATTTACGACATTCGACAAGCCGATC
TTCGACGAGGCCGGCAAGCCCACCTTCAACGTCCAGACTCTCAAGATGCAGTTCCAGGCTCCCCCACAGGTCGGC
GACTTCTCCTTCCTCCTCCACATGATCTGTGACAGCTATCTGGGTCTTGACAACACGGCTCAAATCATCCTGCAC
ATTGACGATCCTGCCAAGGCAGCCGCCGTGCAAGAGGAAGACGACATTAGCGAGCCAGACGAGGACTCCATCGCC
GGCCAAATGCAAGCGATCAAGACCGGCCAAGCGCCTAAGAAGAAGACCAAAGATTCCGACGACTCCAGCGAGAGT
GATACCGACGGCGACGCAGGCGATACCAGCGACACCAACACAGAGACGGAAGACGAGGATTGA
Transcript >Pro_DTO377G3_2|g4022.t1
ATGTCGTCAGACTACACCTATGATGAGCAGGGACAATTCTTCCCCTTCTTCATCCTCACCTTGACCGGCCTGGTC
ACTCTCCCTCTCACCTATAACCTCCTACGACCCAGCAAAGAGCTTGAGAATACCGCTCCCCGCATCAAATCCGAT
TTCAAACCTAAAGATGCGGACCTCATTGACGCGCAGAAGCGCAAGCGTCTCCGAAAAGAGCGCCGAATCAAGCGC
ATTATTACCGTCGTCGTCGGCTATGCCGTAATGGCATGGATGGTCTACTTAATTGTCGTCACCGCTAGGACAGTG
GTGAAGGCATACGACCCTTATGATATTTTGGGTGTCTCGAGGAACGCCGATGAAAAAGCTATCTCCAGACATTAC
AAGCGCATGTCTTTGATCTTTCACCCCGATAAAATTCGTCCTGACCCCTCTAAGAATGAGACCATCGAGATGCTC
AACGAGCGTTTCGTGGAGCTCACCAAGGCATATAAAGCTCTCACCGATGAGGAGGTGCGAAACAACTACCTCCAA
TTTGGCCACCCCGACGGAAAGCAGAGCTTTAGTATCGGTATTGCCCTTCCCAAGTTCATTATCATGGATGGCAAT
GGCAAATATGTTCTGATGGTCTATGGTGCCCTTTTGGGTGTTCTTCTACCATATATCGTCGGCAAGTGGTGGTAT
GGATCTCAGCGCTACACAAAGGAGCGCGTTCTTGTCGCCAGTGCCGGAAACATTTTCCGTGAGTACAAGGACGAT
ATTACCGAAGGTGGGATTATTAGCGCTTTGTCGTCTGGCGAGGAATTCAACGATATGCTCAAGGGTGCCCGGGCC
GAGTCTGGCCTGAACAAGCTCGAGAAGCGGGTGCTGGCAGATGATAATTCGTTCCTTACGCCCAAGGACCGTGAT
ACCCTGAAGCAATTGGATAGCTCCTCTCGTCGGAAGGCCTTGGCTTTGTTATGGGCTTATCTTGGGCGAATTGAT
CTTGGTGATGCTTCTCTGGATGCTGAAAAGTATGAAGCGGCTCCTGTCGCCCTTGCTCTCACTGAAGCTTTCACT
GCTATTTCACTCGCATTTGGTAATCTCGGACCGATCGTCGGTGCCTTCAAAACGTCTCAGAACCTCATCCAGGCT
GTGTCCCCGGGCTCATCACCACTGCTGCAACTTCCCAACTTCACCGAGGCCATTGTCAAGTCCGTAGAGGGCGAA
GACGCCAAGGAACATCTCACCGTCCAAAGGTACATGGAACTACCAGAGGCTCAGCGACGCAGTCTTACTGTCGGC
GCTGGTCTTCTATCCGATAAGCAATACACCGACGCCGTATCAGTTGCCAAGCAACTTCCCTTGCTTCAACCCGAG
CGGATCTTCTTTAAGGTTATGGGAGAAAAGGTGATCACACCCAGCAGTCTGGTACAGCTGGTAGTCAAAGCCCGC
TTCATCCCGCCAGGCAGCACATCCGTGCCGCCAGTGAACCCGCTCGACCTAGAGGACATTGACCCCGACGAGGAC
GACCTGGAAGCCCTGATGGGTCGCAAGCCAGCCAAGAACAGCGCCACTAAGATGGAGGACGGTAAGAAGGTTGAG
GCAAAGATTGAAAGCATCCAGCCGCCTCTGGCCAACGCACCGTACCTAGCGCGCGATCACTCCCCTCGCTGGAAC
ATCTTCCTAGCAGACGGCAAGCAGGGCAAGATGGCCGTACCGCCGTTCACATTTACGACATTCGACAAGCCGATC
TTCGACGAGGCCGGCAAGCCCACCTTCAACGTCCAGACTCTCAAGATGCAGTTCCAGGCTCCCCCACAGGTCGGC
GACTTCTCCTTCCTCCTCCACATGATCTGTGACAGCTATCTGGGTCTTGACAACACGGCTCAAATCATCCTGCAC
ATTGACGATCCTGCCAAGGCAGCCGCCGTGCAAGAGGAAGACGACATTAGCGAGCCAGACGAGGACTCCATCGCC
GGCCAAATGCAAGCGATCAAGACCGGCCAAGCGCCTAAGAAGAAGACCAAAGATTCCGACGACTCCAGCGAGAGT
GATACCGACGGCGACGCAGGCGATACCAGCGACACCAACACAGAGACGGAAGACGAGGATTGA
Gene >Pro_DTO377G3_2|g4022.t1
ATGTCGTCAGACTACACCTATGATGAGCAGGTAAGGACGGGATTTGATCCGATAAAGACGTGGTAACGCTGACTT
GAACCTTCAGGGACAATTCTTCCCCTTCTTCATCCTCACCTTGACCGGCCTGGTCACTCTCCCTCTCACCTATAA
CCTCCTACGACCCAGCAAAGGTGAGACTTGGGACTATATATGTGTGGTTCCCGGCTAACCGCTATATCTGATCTA
CAGAGCTTGAGAATACCGCTCCCCGCATCAAATCCGATTTCAAACCTAAAGATGCGGACCTCATTGACGCGCAGA
AGCGCAAGCGTCTCCGAAAAGAGCGCCGAATCAAGCGCATTATTACCGTCGTCGTCGGCTATGCCGTAATGGCAT
GGATGGTCTACTTAATTGTCGTCACCGCTAGGACAGTGGTGAAGGCATACGACCCTTATGATATTTTGGGTGTCT
CGAGGGTGAGTTATTCAGCTCGGCGCGTGCCTACGTCCAGGGGATTTCACTGACTAAATTCTTGGAAACAGAACG
CCGATGAAAAAGCTATCTCCAGACATTACAAGCGCATGTCTTTGATCTTTCACCCCGATAAAATTCGTCCTGACC
CCTCTAAGAATGAGACCATCGAGATGCTCAACGAGCGTTTCGTGGAGCTCACCAAGGCATATAAAGCTCTCACCG
ATGAGGAGGTGCGAAACAACTACCTCCAATTTGGCCACCCCGACGGAAAGCAGAGCTTTAGTATCGGTATTGCCC
TTCCCAAGTTCATTATCATGGATGGCAATGGCAAATATGTTCTGATGGTCTATGGTGCCCTTTTGGGTGTTCTTC
TACCATATATCGTCGGCAAGTGGTGGTATGGATCTCAGCGCTACACAAAGGAGCGCGTTCTTGTCGCCAGTGCCG
GAAACATTTTCCGTGAGTACAAGGACGATATTACCGAAGGTGGGATTATTAGCGCTTTGTCGTCTGGCGAGGAAT
TCAACGATATGCTCAAGGGTGCCCGGGCCGAGTCTGGCCTGAACAAGCTCGAGAAGCGGGTGCTGGCAGATGATA
ATTCGTTCCTTACGCCCAAGGACCGTGATACCCTGAAGCAATTGGATAGCTCCTCTCGTCGGAAGGCCTTGGCTT
TGTTATGGGCTTATCTTGGGCGAATTGATCTTGGTGATGCTTCTCTGGATGCTGGTAAGAAAAGCCCCGATGATA
TTCTGAAATACCACTAACTGGCCTGCAGAAAAGTATGAAGCGGCTCCTGTCGCCCTTGCTCTCACTGAAGCTTTC
ACTGCTATTTCACTCGCATTTGGTAATCTCGGACCGATCGTCGGTGCCTTCAAAACGTCTCAGAACCTCATCCAG
GCTGTGTCCCCGGGCTCATCACCACTGCTGCAACTTCCCAACTTCACCGAGGCCATTGTCAAGTCCGTAGAGGGC
GAAGACGCCAAGGAACATCTCACCGTCCAAAGGTACATGGAACTACCAGAGGCTCAGCGACGCAGTCTTACTGTC
GGCGCTGGTCTTCTATCCGATAAGCAATACACCGACGCCGTATCAGTTGCCAAGCAACTTCCCTTGCTTCAACCC
GAGCGGATCTTCTTTAAGGTTATGGGAGAAAAGGTGATCACACCCAGCAGTCTGGTACAGCTGGTAGTCAAAGCC
CGCTTCATCCCGCCAGGCAGCACATCCGTGCCGCCAGTGAACCCGCTCGACCTAGAGGACATTGACCCCGACGAG
GACGACCTGGAAGCCCTGATGGGTCGCAAGCCAGCCAAGAACAGCGCCACTAAGATGGAGGACGGTAAGAAGGTT
GAGGCAAAGATTGAAAGCATCCAGCCGCCTCTGGCCAACGCACCGTACCTAGCGCGCGATCACTCCCCTCGCTGG
AACATCTTCCTAGCAGACGGCAAGCAGGGCAAGATGGCCGTACCGCCGTTCACATTTACGACATTCGACAAGCCG
ATCTTCGACGAGGCCGGCAAGCCCACCTTCAACGTCCAGACTCTCAAGATGCAGTTCCAGGCTCCCCCACAGGTC
GGCGACTTCTCCTTCCTCCTCCACATGATCTGTGACAGCTATCTGGGTCTTGACAACACGGCTCAAATCATCCTG
CACATTGACGATCCTGCCAAGGCAGCCGCCGTGCAAGAGGAAGACGACATTAGCGAGCCAGACGAGGGTAAGTCT
TCCCAAACCACTAAACTACCTGTTTCGCTTATACTAACCCTCCCTAGACTCCATCGCCGGCCAAATGCAAGCGAT
CAAGACCGGCCAAGCGCCTAAGAAGAAGACCAAAGATTCCGACGACTCCAGCGAGAGTGATACCGACGGCGACGC
AGGCGATACCAGCGACACCAACACAGAGACGGAAGACGAGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail