Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4020.t1
Gene name
Locationscaffold_07:553813..555283
Strand+
Gene length (bp)1470
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 3.3E-15 164 274

GO

GO Term Description Terminal node
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0016020 membrane Yes
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006644 phospholipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 161 183 22
2 296 318 22
3 372 394 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4020.t1
MLHPHMGCFKSSPGFISQDHDHLQVDRVGKAQVHGSDFLFHPLPFHLFPLSSTLGSFECVLTKRAYLPLSLKFSF
PPGPPPILILTEFAVFLSRPTVRYPYVPRPIRETARQSHPFHITMSATRRQKASLAEESEDAGNSSVSPSEGASA
REETKERKENIFLFTPNLIGYSRVFLTFASLYYMPLHPRTCSFLYTVSCLLDGLDGYAARYFNQSTTFGAVLDMV
TDRCTTACLLVFLSSAWPRWAIIFQGLISLDMASHYMHMYATLSMGGASQSHKKVDPSRSWIMYQYYTSKLVLFI
CCTANEAFFIGLYLLSFSSPTLSPSLLQPISDSQLSSAQPGSPAHPEPASLFASPWSAGALEMARANKLESTWPW
IITGISFPIMAFKQFVNVVQMVNASKWLAEGDLAARRANRKK*
Coding >Pro_DTO377G3_2|g4020.t1
ATGTTGCACCCACATATGGGATGTTTCAAGTCCAGTCCGGGTTTTATCTCTCAAGATCACGATCACCTCCAAGTG
GACCGCGTGGGGAAAGCTCAAGTCCACGGTTCCGACTTCCTCTTTCATCCCCTACCTTTTCATCTTTTCCCTCTT
TCATCGACCCTTGGAAGTTTCGAGTGCGTGTTAACAAAGCGCGCTTATCTTCCCTTATCGTTGAAATTCTCCTTC
CCACCTGGACCACCTCCTATCCTTATCCTGACGGAATTCGCTGTATTCTTATCTCGACCAACTGTCCGGTATCCA
TACGTCCCCCGACCTATACGAGAAACCGCTCGCCAGTCACATCCCTTTCACATCACAATGAGCGCAACACGACGA
CAAAAGGCCTCCCTCGCCGAGGAGAGCGAAGATGCAGGCAATAGCTCCGTGTCACCTTCAGAGGGCGCATCCGCA
CGGGAAGAAACCAAGGAACGCAAGGAAAATATCTTCCTCTTCACTCCGAATCTTATCGGATATTCCCGGGTCTTT
TTGACCTTCGCCTCGCTATACTACATGCCCCTCCACCCCCGGACCTGCTCCTTCCTCTACACGGTGTCCTGTCTG
CTGGACGGCCTGGACGGTTATGCAGCACGATACTTCAACCAATCCACCACTTTCGGTGCGGTGCTGGACATGGTG
ACCGACCGCTGCACCACTGCGTGTCTCCTAGTCTTCCTGAGCTCCGCCTGGCCCCGATGGGCCATCATTTTCCAG
GGTCTGATCAGCTTGGACATGGCTAGCCACTACATGCACATGTACGCTACTCTAAGCATGGGCGGAGCTAGCCAG
AGCCACAAGAAGGTCGATCCTAGCCGTAGCTGGATTATGTACCAGTACTACACCAGCAAGCTCGTTCTGTTCATC
TGCTGTACCGCCAATGAAGCCTTCTTCATCGGCCTGTACCTCCTGTCCTTCTCCTCGCCAACCCTCTCCCCTTCG
CTCCTGCAGCCCATCTCCGATTCCCAGCTGTCCTCCGCCCAGCCTGGAAGCCCCGCGCACCCCGAACCAGCTAGC
CTCTTCGCTAGCCCCTGGAGCGCCGGAGCCCTCGAGATGGCGCGTGCGAACAAGCTCGAGAGCACCTGGCCGTGG
ATCATCACCGGCATCTCGTTCCCCATCATGGCGTTCAAGCAGTTCGTCAACGTCGTCCAGATGGTGAACGCCAGC
AAGTGGCTCGCTGAGGGCGATCTCGCTGCCCGCCGAGCTAACCGCAAGAAGTAA
Transcript >Pro_DTO377G3_2|g4020.t1
ATGTTGCACCCACATATGGGATGTTTCAAGTCCAGTCCGGGTTTTATCTCTCAAGATCACGATCACCTCCAAGTG
GACCGCGTGGGGAAAGCTCAAGTCCACGGTTCCGACTTCCTCTTTCATCCCCTACCTTTTCATCTTTTCCCTCTT
TCATCGACCCTTGGAAGTTTCGAGTGCGTGTTAACAAAGCGCGCTTATCTTCCCTTATCGTTGAAATTCTCCTTC
CCACCTGGACCACCTCCTATCCTTATCCTGACGGAATTCGCTGTATTCTTATCTCGACCAACTGTCCGGTATCCA
TACGTCCCCCGACCTATACGAGAAACCGCTCGCCAGTCACATCCCTTTCACATCACAATGAGCGCAACACGACGA
CAAAAGGCCTCCCTCGCCGAGGAGAGCGAAGATGCAGGCAATAGCTCCGTGTCACCTTCAGAGGGCGCATCCGCA
CGGGAAGAAACCAAGGAACGCAAGGAAAATATCTTCCTCTTCACTCCGAATCTTATCGGATATTCCCGGGTCTTT
TTGACCTTCGCCTCGCTATACTACATGCCCCTCCACCCCCGGACCTGCTCCTTCCTCTACACGGTGTCCTGTCTG
CTGGACGGCCTGGACGGTTATGCAGCACGATACTTCAACCAATCCACCACTTTCGGTGCGGTGCTGGACATGGTG
ACCGACCGCTGCACCACTGCGTGTCTCCTAGTCTTCCTGAGCTCCGCCTGGCCCCGATGGGCCATCATTTTCCAG
GGTCTGATCAGCTTGGACATGGCTAGCCACTACATGCACATGTACGCTACTCTAAGCATGGGCGGAGCTAGCCAG
AGCCACAAGAAGGTCGATCCTAGCCGTAGCTGGATTATGTACCAGTACTACACCAGCAAGCTCGTTCTGTTCATC
TGCTGTACCGCCAATGAAGCCTTCTTCATCGGCCTGTACCTCCTGTCCTTCTCCTCGCCAACCCTCTCCCCTTCG
CTCCTGCAGCCCATCTCCGATTCCCAGCTGTCCTCCGCCCAGCCTGGAAGCCCCGCGCACCCCGAACCAGCTAGC
CTCTTCGCTAGCCCCTGGAGCGCCGGAGCCCTCGAGATGGCGCGTGCGAACAAGCTCGAGAGCACCTGGCCGTGG
ATCATCACCGGCATCTCGTTCCCCATCATGGCGTTCAAGCAGTTCGTCAACGTCGTCCAGATGGTGAACGCCAGC
AAGTGGCTCGCTGAGGGCGATCTCGCTGCCCGCCGAGCTAACCGCAAGAAGTAA
Gene >Pro_DTO377G3_2|g4020.t1
ATGTTGCACCCACATATGGGATGTTTCAAGTCCAGTCCGGGTTTTATCTCTCAAGATCACGATCACCTCCAAGTG
GACCGCGTGGGGAAAGCTCAAGTCCACGGTTCCGAGTAACCCGCAGACATTCCACAATTTCCTTTCCTCCATCTT
TCCAGCTTCCTCTTTCATCCCCTACCTTTTCATCTTTTCCCTCTTTCATCGACCCTTGGAAGTTTCGAGTGCGTG
TTAACAAAGCGCGCTTATCTTCCCTTATCGTTGAAATTCTCCTTCCCACCTGGACCACCTCCTATCCTTATCCTG
ACGGAATTCGCTGTATTCTTATCTCGGTGCGTTTCTGTCTTTGCTTCTTGATTACCCGACGCTGACAGCGCTTAG
ACCAACTGTCCGGTATCCATACGTCCCCCGACCTATACGAGAAACCGCTCGCCAGTCACATCCCTTTCACATCAC
AATGAGCGCAACACGACGACAAAAGGCCTCCCTCGCCGAGGAGAGCGAAGATGCAGGCAATAGCTCCGTGTCACC
TTCAGAGGGCGCATCCGCACGGGAAGAAACCAAGGAACGCAAGGAAAATATCTTCCTCTTCACTCCGAATCTTAT
CGGTAGAATGCCCCGCTGATGTGGCTTTAAGCCTGACGTTGGCATCTGGTTTAACACGTTCCCAGGATATTCCCG
GGTCTTTTTGACCTTCGCCTCGCTATACTACATGCCCCTCCACCCCCGGACCTGCTCCTTCCTCTACACGGTGTC
CTGTCTGCTGGACGGCCTGGACGGTTATGCAGCACGATACTTCAACCAATCCACCACTTTCGGTGCGGTGCTGGA
CATGGTGACCGACCGCTGCACCACTGCGTGTCTCCTAGTCTTCCTGAGCTCCGCCTGGCCCCGATGGGCCATCAT
TTTCCAGGGTCTGATCAGCTTGGACATGGCTAGCCACTACATGCACATGTACGCTACTCTAAGCATGGGCGGAGC
TAGCCAGAGCCACAAGAAGGTCGATCCTAGCCGTAGCTGGATTATGTACCAGTACTACACCAGCAAGGTAAGGCC
CCGCAGTGAACTGATATTCCGTCCCCAAGCTTATTCGCAATGTTTTGTTAGCTCGTTCTGTTCATCTGCTGTACC
GCCAATGAAGCCTTCTTCATCGGCCTGTACCTCCTGTCCTTCTCCTCGCCAACCCTCTCCCCTTCGCTCCTGCAG
CCCATCTCCGATTCCCAGCTGTCCTCCGCCCAGCCTGGAAGCCCCGCGCACCCCGAACCAGCTAGCCTCTTCGCT
AGCCCCTGGAGCGCCGGAGCCCTCGAGATGGCGCGTGCGAACAAGCTCGAGAGCACCTGGCCGTGGATCATCACC
GGCATCTCGTTCCCCATCATGGCGTTCAAGCAGTTCGTCAACGTCGTCCAGATGGTGAACGCCAGCAAGTGGCTC
GCTGAGGGCGATCTCGCTGCCCGCCGAGCTAACCGCAAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail