Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4018.t1
Gene name
Locationscaffold_07:549379..551194
Strand+
Gene length (bp)1815
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-13 168 233
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-19 268 337
PF15519 RBM39linker linker between RRM2 and RRM3 domains in RBM39 protein 1.6E-23 399 474

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 77.98 47.91 108.06
5d_25C Five days - 25 degrees Celsius 180.37 108.07 252.67
7d_25C Seven days - 25 degrees Celsius 214.82 126.19 303.44
10d_25C Ten days - 25 degrees Celsius 445.41 246.43 644.38
7d_15C Seven days - 15 degrees Celsius 174.40 102.34 246.45
7d_30C Seven days - 30 degrees Celsius 329.37 187.13 471.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.512830 no
5d_25C 7d_15C 0.922915 no
5d_25C 7d_30C 0.005235 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.427656 no
7d_25C 7d_30C 0.062138 no
7d_25C 10d_25C 0.001278 yes
7d_15C 7d_30C 0.002297 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.240532 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4018.t1
MSGLDVEALLESTAAAPIEAPVEAPATSDSRADPTERRDRSRDRRRRRDHSRDRRPDRDLQGDEVAKSDTVSANG
SLRSRKRSKSRESERRRSRRDRDGYRSNGDFYRGGGRVRSRSRSPYDDRHYRPNRRQREEERRPRRDADVRRGSA
ASRKSPELNEDERDSRTVFVQQLAARLRIKDLIAFFEKAGPVKDAQIVRDRVNGRSKGVGYVEFKNEESVSAAIR
LTGQMLAGIPVIAQLTEAEKNRQAARNPEAPAGNHHTAPFHRLYVGNVHFSITEKDITNVFEPFGDLEFVQLQTD
ESGRSKGYAFVQFAHPDQARNALEKMNGFDLAGRNIRVGLGNDKFTPDSHANRASGASTNFQGSSFSGQGGRGVQ
AGGSNNFDRAGGRETEKGAGASALDDTDVAGVNFNNYSRDALMRKLARTDEPQSSVDDRQKFLRPKTETKPLPIN
VNMASRCVLLRNMFDPALEHSPTWVKDLEEDVRTECEKKYGHVVHISLDPNSVGDIYLKFDRVQGGENAIKGLNG
RYFGGKMCTAQPVVDAVYSSLFSRTRAI*
Coding >Pro_DTO377G3_2|g4018.t1
ATGTCTGGACTTGACGTAGAGGCTCTCCTTGAGTCTACTGCGGCCGCCCCCATCGAGGCCCCCGTCGAGGCCCCC
GCCACTTCGGATTCCCGCGCGGACCCCACCGAGCGCCGTGATCGTTCCCGCGACAGACGTCGTCGCCGCGACCAC
AGCCGTGACCGCCGCCCTGACCGTGACCTTCAGGGAGACGAAGTCGCCAAGAGCGACACTGTTAGTGCTAATGGA
AGCCTTAGAAGCCGAAAGAGGAGCAAGAGTCGCGAATCTGAGAGACGCCGTTCTCGCCGTGACCGTGACGGCTAC
CGCTCCAACGGTGACTTCTACCGTGGTGGAGGTCGCGTTCGTTCCCGCTCCCGTTCTCCCTATGACGATCGCCAC
TACCGGCCCAATCGCCGCCAGCGTGAGGAAGAACGACGCCCCCGCCGTGATGCTGATGTTCGCCGTGGATCCGCC
GCCAGCCGCAAGTCTCCAGAACTGAACGAGGATGAACGTGACAGTCGCACTGTCTTTGTGCAGCAACTTGCTGCC
CGCCTGAGAATCAAGGATTTGATTGCCTTCTTTGAAAAGGCCGGCCCCGTTAAGGATGCTCAAATCGTCCGGGAT
CGTGTTAACGGTCGCTCCAAAGGTGTCGGTTATGTCGAGTTCAAAAACGAGGAGTCTGTCTCCGCCGCCATCCGA
CTCACCGGCCAGATGCTCGCAGGAATTCCCGTCATTGCCCAACTGACTGAAGCGGAAAAGAACCGCCAGGCAGCC
CGAAACCCGGAGGCTCCAGCAGGAAACCACCACACCGCACCCTTCCACAGACTTTATGTCGGTAATGTTCACTTC
AGCATTACCGAGAAGGATATCACCAATGTCTTCGAACCATTTGGCGACCTCGAGTTCGTTCAGCTGCAAACGGAC
GAGAGTGGTAGAAGCAAGGGATATGCATTCGTTCAATTTGCCCACCCCGATCAAGCTCGGAACGCTTTGGAAAAG
ATGAACGGCTTTGACCTTGCTGGACGAAATATTCGGGTTGGTCTCGGCAATGATAAGTTCACCCCCGACTCGCAC
GCCAATCGCGCCTCAGGTGCTTCTACAAACTTCCAGGGTTCTTCGTTCTCCGGCCAGGGAGGTCGTGGCGTTCAA
GCCGGAGGCTCCAACAACTTTGACCGTGCTGGCGGCAGAGAAACTGAAAAGGGTGCCGGTGCTAGTGCACTTGAC
GACACAGATGTTGCTGGCGTAAACTTCAACAACTACTCTAGGGATGCTTTGATGAGAAAGCTTGCACGAACCGAC
GAACCCCAGTCTTCTGTTGACGACCGTCAGAAATTCCTCCGACCCAAGACCGAAACTAAGCCGCTTCCCATCAAT
GTCAACATGGCTAGTCGCTGTGTTTTGCTGCGCAACATGTTTGACCCCGCGCTAGAGCACAGTCCAACCTGGGTC
AAGGACCTCGAAGAGGACGTCCGAACGGAGTGTGAGAAGAAATACGGCCACGTTGTTCACATTTCACTAGATCCC
AATTCCGTCGGAGATATCTATCTGAAGTTCGACCGCGTCCAAGGTGGCGAGAACGCCATCAAGGGCCTCAATGGT
CGATACTTCGGTGGAAAGATGTGCACCGCCCAACCCGTCGTGGATGCAGTTTACAGCAGTCTTTTCTCTCGAACT
AGGGCCATCTAA
Transcript >Pro_DTO377G3_2|g4018.t1
ATGTCTGGACTTGACGTAGAGGCTCTCCTTGAGTCTACTGCGGCCGCCCCCATCGAGGCCCCCGTCGAGGCCCCC
GCCACTTCGGATTCCCGCGCGGACCCCACCGAGCGCCGTGATCGTTCCCGCGACAGACGTCGTCGCCGCGACCAC
AGCCGTGACCGCCGCCCTGACCGTGACCTTCAGGGAGACGAAGTCGCCAAGAGCGACACTGTTAGTGCTAATGGA
AGCCTTAGAAGCCGAAAGAGGAGCAAGAGTCGCGAATCTGAGAGACGCCGTTCTCGCCGTGACCGTGACGGCTAC
CGCTCCAACGGTGACTTCTACCGTGGTGGAGGTCGCGTTCGTTCCCGCTCCCGTTCTCCCTATGACGATCGCCAC
TACCGGCCCAATCGCCGCCAGCGTGAGGAAGAACGACGCCCCCGCCGTGATGCTGATGTTCGCCGTGGATCCGCC
GCCAGCCGCAAGTCTCCAGAACTGAACGAGGATGAACGTGACAGTCGCACTGTCTTTGTGCAGCAACTTGCTGCC
CGCCTGAGAATCAAGGATTTGATTGCCTTCTTTGAAAAGGCCGGCCCCGTTAAGGATGCTCAAATCGTCCGGGAT
CGTGTTAACGGTCGCTCCAAAGGTGTCGGTTATGTCGAGTTCAAAAACGAGGAGTCTGTCTCCGCCGCCATCCGA
CTCACCGGCCAGATGCTCGCAGGAATTCCCGTCATTGCCCAACTGACTGAAGCGGAAAAGAACCGCCAGGCAGCC
CGAAACCCGGAGGCTCCAGCAGGAAACCACCACACCGCACCCTTCCACAGACTTTATGTCGGTAATGTTCACTTC
AGCATTACCGAGAAGGATATCACCAATGTCTTCGAACCATTTGGCGACCTCGAGTTCGTTCAGCTGCAAACGGAC
GAGAGTGGTAGAAGCAAGGGATATGCATTCGTTCAATTTGCCCACCCCGATCAAGCTCGGAACGCTTTGGAAAAG
ATGAACGGCTTTGACCTTGCTGGACGAAATATTCGGGTTGGTCTCGGCAATGATAAGTTCACCCCCGACTCGCAC
GCCAATCGCGCCTCAGGTGCTTCTACAAACTTCCAGGGTTCTTCGTTCTCCGGCCAGGGAGGTCGTGGCGTTCAA
GCCGGAGGCTCCAACAACTTTGACCGTGCTGGCGGCAGAGAAACTGAAAAGGGTGCCGGTGCTAGTGCACTTGAC
GACACAGATGTTGCTGGCGTAAACTTCAACAACTACTCTAGGGATGCTTTGATGAGAAAGCTTGCACGAACCGAC
GAACCCCAGTCTTCTGTTGACGACCGTCAGAAATTCCTCCGACCCAAGACCGAAACTAAGCCGCTTCCCATCAAT
GTCAACATGGCTAGTCGCTGTGTTTTGCTGCGCAACATGTTTGACCCCGCGCTAGAGCACAGTCCAACCTGGGTC
AAGGACCTCGAAGAGGACGTCCGAACGGAGTGTGAGAAGAAATACGGCCACGTTGTTCACATTTCACTAGATCCC
AATTCCGTCGGAGATATCTATCTGAAGTTCGACCGCGTCCAAGGTGGCGAGAACGCCATCAAGGGCCTCAATGGT
CGATACTTCGGTGGAAAGATGTGCACCGCCCAACCCGTCGTGGATGCAGTTTACAGCAGTCTTTTCTCTCGAACT
AGGGCCATCTAA
Gene >Pro_DTO377G3_2|g4018.t1
ATGTCTGGACTTGACGTAGAGGCTCTCCTTGAGTCTACTGCGGCCGCCCCCATCGAGGCCCCCGTCGAGGCCCCC
GCCACTTCGGATTCCCGCGCGGACCCCACCGAGCGCCGTGATCGTTCCCGCGACAGACGTCGTCGCCGCGACCAC
AGCCGTGACCGCCGCCCTGACCGTGACCTTCAGGGAGACGAAGTCGCCAAGAGCGACACTGTTAGTGCTAATGGA
AGCCTTAGAAGCCGAAAGAGGAGCAAGAGTCGCGAATCTGAGAGACGCCGTTCTCGCCGTGACCGTGACGGCTAC
CGCTCCAACGGTGACTTCTACCGTGGTGGAGGTCGCGTTCGTTCCCGCTCCCGTTCTCCCTATGACGATCGCCAC
TACCGGCCCAATCGCCGCCAGCGTGAGGAAGAACGACGCCCCCGCCGTGATGCTGATGTTCGCCGTGGATCCGCC
GCCAGCCGCAAGTCTCCAGAACTGAACGAGGATGAACGTGACAGTCGCACTGTCTTTGTGCAGCAACTTGCTGCC
CGCCTGAGAATCAAGGATTTGATTGCCTTCTTTGAAAAGGCCGGCCCCGTTAAGGATGCTCAAATCGTCCGGGAT
CGTGTTAACGGTCGCTCCAAAGGGTATGTATTCACATGATTACTTGGTTAAAGCACTTTCTCATATTTTGTATAG
TGTCGGTTATGTCGAGTTCAAAAACGAGGAGTCTGTCTCCGCCGCCATCCGACTCACCGGCCAGATGCTCGCAGG
AATTCCCGTCATTGCCCAACTGACTGAAGCGGAAAAGAACCGCCAGGCAGCCCGAAACCCGGAGGCTCCAGCAGG
AAACCACCACACCGCACCCTTCCACAGACTTTATGTCGGTAATGTTCACTTCAGCATTACCGAGAAGGATATCAC
CAATGTCTTCGAACCATTTGGCGACCTCGAGTTCGTTCAGCTGCAAACGGACGAGAGTGGTAGAAGCAAGGGATA
TGCATTCGTTCAGTACGTTGTCCGTCCATGTTATTGACACTTCCATTAACTGACTTGACCAGATTTGCCCACCCC
GATCAAGCTCGGAACGCTTTGGAAAAGATGAACGGCTTTGACCTTGCTGGACGAAATATTCGGGTTGGTCTCGGC
AATGATAAGTTCACCCCCGACTCGCACGCCAATCGCGCCTCAGGTGCTTCTACAAACTTCCAGGGTTCTTCGTTC
TCCGGCCAGGGAGGTCGTGGCGTTCAAGCCGGAGGCTCCAACAACTTTGACCGTGCTGGCGGCAGAGAAACTGAA
AAGGGTGCCGGTGCTAGTGCACTTGACGACACAGATGTTGCTGGCGTAAACTTCAACAACTACTCTAGGGATGCT
TTGATGAGAAAGCTTGCACGAACCGACGAACCCCAGTCTTCTGTTGACGACCGTCAGAAATTCCTCCGACCCAAG
ACCGAAACTAAGCCGCTTCCCATCAATGTCAACATGGCTAGTCGCTGTGTTTTGCTGCGCAACATGTTTGACCCC
GCGCTGTAAGTTTCCTTGACGCCATCATGAGAGAATGAACGCTGACTTCTTTACAGAGAGCACAGTCCAACCTGG
GTCAAGGACCTCGAAGAGGACGTCCGAACGGAGTGTGAGAAGAAATACGGCCACGTTGTTCACATTTCACTAGAT
CCCAATTCCGTCGGAGATATCTATCTGAAGTTCGACCGCGTCCAAGGTGGCGAGAACGCCATCAAGGGCCTCAAT
GGTCGATACTTCGGTGGAAAGATGTGCACCGCCCAACCCGTCGTGGATGCAGTTTACAGCAGTCTTTTCTCTCGA
ACTAGGGCCATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail