Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3997.t1
Gene name
Locationscaffold_07:483719..485828
Strand+
Gene length (bp)2109
Transcript length (bp)1905
Coding sequence length (bp)1905
Protein length (aa) 635

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 1.7E-72 28 400

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 24.63 13.50 35.77
5d_25C Five days - 25 degrees Celsius 43.04 25.99 60.10
7d_25C Seven days - 25 degrees Celsius 58.08 32.03 84.13
10d_25C Ten days - 25 degrees Celsius 30.48 17.03 43.92
7d_15C Seven days - 15 degrees Celsius 21.52 10.30 32.75
7d_30C Seven days - 30 degrees Celsius 36.37 20.33 52.40

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.017204 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.709594 no
3d_25C 7d_30C 0.132659 no
3d_25C 10d_25C 0.481923 no
5d_25C 7d_25C 0.227225 no
5d_25C 7d_15C 0.007091 yes
5d_25C 7d_30C 0.567211 no
5d_25C 10d_25C 0.167878 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.049382 yes
7d_25C 10d_25C 0.003197 yes
7d_15C 7d_30C 0.046354 yes
7d_15C 10d_25C 0.229193 no
7d_30C 10d_25C 0.570352 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3997.t1
MAFKLPASIAVAIALGTGLVSGGSLKDIEHVVIFMQENRSWDTYFGTMPGVRGFNDPNVQVNPDGNSVWNQLVEP
AQSNKTKTLLPWYLGYQGGDWNDAIQCMSAGSNSYEENQQSLNYGLNNHWVTNNTPWSWGYLKRQDIPVQFAIAE
GWTSGDMYQESQITATNPNRVTLVSGSINVPGSPQSKDQGGVYIDNNEVPGCDDNGINCYPLKWKTVYDFYEEAG
VSWQLYQDTNNFDDNPLAWFDQFQTAPQNSSLAKKGMSFVGLDSFYQAAANGTLPEVSFIVGPAELSEHPPYMPK
DGGWLQKKVVDAVTSSPKYNSTLLMISYDETGGFGDHVTPFHSPKDTPGEWMQDPLGMFTDIFTGPGFRVPFYMI
SPWTRGNRVFTERADHNSQILFVEEWLTARGYENITTDQMVEWRRKHMSNLVNALDLHNPDYSLPSLPDAGTVDT
NAKGEYTGTSNCQARYKQTRPDVPYGEQSNATDVNTLWFEEGFKEVVGYLTEGRYLTFEKNGAALTNPARGNSLV
SSPASPQHNNKAQRWVIHYNNDEESQTFTVSSALDGRWVGPDGVLLPKSHSAKAAQVHFTFLGGGLGYTMQFVEK
GQYIDIDKHGHLDTETRKTRPASGYQVFSVSFRN*
Coding >Pro_DTO377G3_2|g3997.t1
ATGGCTTTCAAATTGCCGGCGTCTATCGCGGTCGCGATAGCCCTGGGAACGGGACTCGTGTCTGGTGGATCTCTA
AAAGACATTGAACATGTCGTCATCTTCATGCAGGAGAATCGCTCGTGGGACACGTATTTCGGCACTATGCCTGGA
GTCCGGGGATTCAATGATCCCAATGTCCAGGTCAACCCAGACGGAAACTCGGTCTGGAATCAATTAGTCGAGCCG
GCCCAATCAAACAAGACCAAGACCTTGCTACCCTGGTATCTTGGATATCAAGGCGGCGACTGGAATGATGCAATT
CAGTGCATGTCTGCGGGTAGCAACAGCTACGAGGAGAACCAGCAATCTCTCAACTATGGGTTGAACAATCACTGG
GTGACAAACAACACACCCTGGAGCTGGGGGTATTTGAAGCGGCAAGATATTCCAGTTCAATTTGCTATTGCTGAA
GGTTGGACATCGGGAGATATGTATCAGGAAAGCCAAATCACTGCCACAAATCCTAATCGGGTTACTTTGGTCAGC
GGCTCCATCAACGTTCCTGGTAGTCCCCAGAGCAAGGACCAGGGAGGTGTTTATATTGACAATAATGAGGTACCA
GGCTGTGATGACAACGGTATCAACTGCTACCCACTCAAGTGGAAGACAGTCTATGACTTTTATGAAGAGGCGGGA
GTCTCTTGGCAACTCTACCAAGACACAAACAACTTTGACGACAACCCTCTGGCTTGGTTCGACCAATTTCAAACT
GCCCCGCAAAACAGTTCTCTGGCTAAAAAGGGTATGTCGTTCGTGGGCCTTGATTCCTTCTACCAAGCTGCCGCC
AACGGCACATTACCCGAGGTTAGTTTCATTGTCGGGCCGGCGGAGCTGTCAGAGCACCCGCCGTACATGCCAAAG
GACGGAGGCTGGCTTCAGAAGAAGGTCGTCGATGCCGTCACCAGTAGCCCGAAGTACAACTCGACCCTTCTGATG
ATCAGCTATGATGAGACTGGTGGCTTTGGCGACCATGTCACCCCCTTCCATTCTCCTAAGGATACCCCGGGAGAA
TGGATGCAGGACCCCTTGGGTATGTTCACGGATATCTTCACAGGACCTGGTTTCCGGGTACCATTCTATATGATC
TCCCCCTGGACTCGCGGAAACCGTGTGTTCACCGAGCGGGCAGATCACAACTCCCAGATTCTCTTCGTTGAGGAA
TGGTTGACTGCACGGGGATACGAAAATATCACAACCGATCAGATGGTTGAATGGAGACGCAAGCACATGTCTAAT
CTAGTCAACGCGCTTGATTTGCACAATCCAGACTACTCTCTCCCCAGTCTCCCTGATGCCGGGACCGTGGATACC
AACGCCAAGGGCGAGTATACCGGTACATCTAACTGCCAGGCACGTTACAAGCAGACACGTCCGGATGTTCCCTAT
GGAGAACAGAGCAACGCAACGGATGTCAATACCCTGTGGTTTGAAGAAGGTTTCAAAGAGGTGGTTGGCTACCTC
ACCGAGGGCCGATACCTAACCTTTGAGAAGAATGGAGCAGCCCTCACGAATCCGGCCAGAGGCAACAGCCTTGTG
TCCAGCCCTGCAAGCCCTCAGCACAACAATAAAGCGCAGCGTTGGGTGATCCACTACAACAATGACGAGGAAAGC
CAGACATTTACCGTCTCCAGCGCACTGGATGGTCGATGGGTCGGCCCCGATGGTGTTCTGCTTCCCAAAAGCCAC
AGCGCAAAGGCAGCCCAAGTGCATTTCACCTTCCTAGGTGGTGGCCTTGGCTATACCATGCAGTTTGTGGAGAAG
GGGCAATACATCGATATTGACAAGCACGGACACTTGGATACTGAAACCCGCAAGACTAGACCTGCTAGTGGCTAC
CAGGTCTTCAGCGTCTCTTTCCGTAATTAG
Transcript >Pro_DTO377G3_2|g3997.t1
ATGGCTTTCAAATTGCCGGCGTCTATCGCGGTCGCGATAGCCCTGGGAACGGGACTCGTGTCTGGTGGATCTCTA
AAAGACATTGAACATGTCGTCATCTTCATGCAGGAGAATCGCTCGTGGGACACGTATTTCGGCACTATGCCTGGA
GTCCGGGGATTCAATGATCCCAATGTCCAGGTCAACCCAGACGGAAACTCGGTCTGGAATCAATTAGTCGAGCCG
GCCCAATCAAACAAGACCAAGACCTTGCTACCCTGGTATCTTGGATATCAAGGCGGCGACTGGAATGATGCAATT
CAGTGCATGTCTGCGGGTAGCAACAGCTACGAGGAGAACCAGCAATCTCTCAACTATGGGTTGAACAATCACTGG
GTGACAAACAACACACCCTGGAGCTGGGGGTATTTGAAGCGGCAAGATATTCCAGTTCAATTTGCTATTGCTGAA
GGTTGGACATCGGGAGATATGTATCAGGAAAGCCAAATCACTGCCACAAATCCTAATCGGGTTACTTTGGTCAGC
GGCTCCATCAACGTTCCTGGTAGTCCCCAGAGCAAGGACCAGGGAGGTGTTTATATTGACAATAATGAGGTACCA
GGCTGTGATGACAACGGTATCAACTGCTACCCACTCAAGTGGAAGACAGTCTATGACTTTTATGAAGAGGCGGGA
GTCTCTTGGCAACTCTACCAAGACACAAACAACTTTGACGACAACCCTCTGGCTTGGTTCGACCAATTTCAAACT
GCCCCGCAAAACAGTTCTCTGGCTAAAAAGGGTATGTCGTTCGTGGGCCTTGATTCCTTCTACCAAGCTGCCGCC
AACGGCACATTACCCGAGGTTAGTTTCATTGTCGGGCCGGCGGAGCTGTCAGAGCACCCGCCGTACATGCCAAAG
GACGGAGGCTGGCTTCAGAAGAAGGTCGTCGATGCCGTCACCAGTAGCCCGAAGTACAACTCGACCCTTCTGATG
ATCAGCTATGATGAGACTGGTGGCTTTGGCGACCATGTCACCCCCTTCCATTCTCCTAAGGATACCCCGGGAGAA
TGGATGCAGGACCCCTTGGGTATGTTCACGGATATCTTCACAGGACCTGGTTTCCGGGTACCATTCTATATGATC
TCCCCCTGGACTCGCGGAAACCGTGTGTTCACCGAGCGGGCAGATCACAACTCCCAGATTCTCTTCGTTGAGGAA
TGGTTGACTGCACGGGGATACGAAAATATCACAACCGATCAGATGGTTGAATGGAGACGCAAGCACATGTCTAAT
CTAGTCAACGCGCTTGATTTGCACAATCCAGACTACTCTCTCCCCAGTCTCCCTGATGCCGGGACCGTGGATACC
AACGCCAAGGGCGAGTATACCGGTACATCTAACTGCCAGGCACGTTACAAGCAGACACGTCCGGATGTTCCCTAT
GGAGAACAGAGCAACGCAACGGATGTCAATACCCTGTGGTTTGAAGAAGGTTTCAAAGAGGTGGTTGGCTACCTC
ACCGAGGGCCGATACCTAACCTTTGAGAAGAATGGAGCAGCCCTCACGAATCCGGCCAGAGGCAACAGCCTTGTG
TCCAGCCCTGCAAGCCCTCAGCACAACAATAAAGCGCAGCGTTGGGTGATCCACTACAACAATGACGAGGAAAGC
CAGACATTTACCGTCTCCAGCGCACTGGATGGTCGATGGGTCGGCCCCGATGGTGTTCTGCTTCCCAAAAGCCAC
AGCGCAAAGGCAGCCCAAGTGCATTTCACCTTCCTAGGTGGTGGCCTTGGCTATACCATGCAGTTTGTGGAGAAG
GGGCAATACATCGATATTGACAAGCACGGACACTTGGATACTGAAACCCGCAAGACTAGACCTGCTAGTGGCTAC
CAGGTCTTCAGCGTCTCTTTCCGTAATTAG
Gene >Pro_DTO377G3_2|g3997.t1
ATGGCTTTCAAATTGCCGGCGTCTATCGCGGTCGCGATAGCCCTGGGAACGGGACTCGTGTCTGGTGGATCTCTA
AAAGACATTGAACATGTCGTCATCTTCATGCAGGAGAATCGCTCGTGGGACACGGCACGTTTTGCCTGCACTATG
AAACATTGACATCGTGCTCACCAAATCGCAGTATTTCGGCACTATGCCTGGAGTCCGGGGATTCAATGATCCCAA
TGTCCAGGTCAACCCAGACGGAAACTCGGTCTGGAATCAGTAAGTGCCGCCTCTAAGGGAGAAGTTAGTTCTAAC
ATTCCTGGTCAGATTAGTCGAGCCGGCCCAATCAAACAAGACCAAGACCTTGCTACCCTGGTATCTTGGATATCA
AGGCGGCGACTGGAATGATGCAATTCAGTGCATGTCTGCGGGTAGCAACAGCTACGAGGAGAACCAGCAATCTCT
CAACTATGGGTTGAACAATCACTGGGTGACAAACAACACACCCTGGAGCTGGGGGTATTTGAAGCGGCAAGATAT
TCCAGTTCAATTTGCTATTGCTGAAGGTTGGACATCGGGAGATATGTATCAGGTGCGTGGCAAGACTCGTTTTCA
GAAATTGGTGACTAATTTACAAGCAGGAAAGCCAAATCACTGCCACAAATCCTAATCGGGTTACTTTGGTCAGCG
GCTCCATCAACGTTCCTGGTAGTCCCCAGAGCAAGGACCAGGGAGGTGTTTATATTGACAATAATGAGGTACCAG
GTATGTATCGTCGGCTCTCTCTTCTGTTAATATTTTTGATCTAACCAAATTATAGGCTGTGATGACAACGGTATC
AACTGCTACCCACTCAAGTGGAAGACAGTCTATGACTTTTATGAAGAGGCGGGAGTCTCTTGGCAACTCTACCAA
GACACAAACAACTTTGACGACAACCCTCTGGCTTGGTTCGACCAATTTCAAACTGCCCCGCAAAACAGTTCTCTG
GCTAAAAAGGGTATGTCGTTCGTGGGCCTTGATTCCTTCTACCAAGCTGCCGCCAACGGCACATTACCCGAGGTT
AGTTTCATTGTCGGGCCGGCGGAGCTGTCAGAGCACCCGCCGTACATGCCAAAGGACGGAGGCTGGCTTCAGAAG
AAGGTCGTCGATGCCGTCACCAGTAGCCCGAAGTACAACTCGACCCTTCTGATGATCAGCTATGATGAGACTGGT
GGCTTTGGCGACCATGTCACCCCCTTCCATTCTCCTAAGGATACCCCGGGAGAATGGATGCAGGACCCCTTGGGT
ATGTTCACGGATATCTTCACAGGACCTGGTTTCCGGGTACCATTCTATATGATCTCCCCCTGGACTCGCGGAAAC
CGTGTGTTCACCGAGCGGGCAGATCACAACTCCCAGATTCTCTTCGTTGAGGAATGGTTGACTGCACGGGGATAC
GAAAATATCACAACCGATCAGATGGTTGAATGGAGACGCAAGCACATGTCTAATCTAGTCAACGCGCTTGATTTG
CACAATCCAGACTACTCTCTCCCCAGTCTCCCTGATGCCGGGACCGTGGATACCAACGCCAAGGGCGAGTATACC
GGTACATCTAACTGCCAGGCACGTTACAAGCAGACACGTCCGGATGTTCCCTATGGAGAACAGAGCAACGCAACG
GATGTCAATACCCTGTGGTTTGAAGAAGGTTTCAAAGAGGTGGTTGGCTACCTCACCGAGGGCCGATACCTAACC
TTTGAGAAGAATGGAGCAGCCCTCACGAATCCGGCCAGAGGCAACAGCCTTGTGTCCAGCCCTGCAAGCCCTCAG
CACAACAATAAAGCGCAGCGTTGGGTGATCCACTACAACAATGACGAGGAAAGCCAGACATTTACCGTCTCCAGC
GCACTGGATGGTCGATGGGTCGGCCCCGATGGTGTTCTGCTTCCCAAAAGCCACAGCGCAAAGGCAGCCCAAGTG
CATTTCACCTTCCTAGGTGGTGGCCTTGGCTATACCATGCAGTTTGTGGAGAAGGGGCAATACATCGATATTGAC
AAGCACGGACACTTGGATACTGAAACCCGCAAGACTAGACCTGCTAGTGGCTACCAGGTCTTCAGCGTCTCTTTC
CGTAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail