Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g393.t1
Gene name
Locationscaffold_01:998834..1000740
Strand-
Gene length (bp)1906
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 4.5E-41 307 461

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0018208 peptidyl-proline modification No
GO:0003824 catalytic activity No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0016853 isomerase activity No
GO:0018193 peptidyl-amino acid modification No
GO:0016859 cis-trans isomerase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 45.18 27.14 63.21
5d_25C Five days - 25 degrees Celsius 49.93 30.20 69.67
7d_25C Seven days - 25 degrees Celsius 56.95 34.54 79.36
10d_25C Ten days - 25 degrees Celsius 75.88 46.22 105.55
7d_15C Seven days - 15 degrees Celsius 48.08 28.75 67.41
7d_30C Seven days - 30 degrees Celsius 40.15 23.67 56.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.736114 no
3d_25C 7d_25C 0.335813 no
3d_25C 7d_15C 0.847794 no
3d_25C 7d_30C 0.689691 no
3d_25C 10d_25C 0.009124 yes
5d_25C 7d_25C 0.627916 no
5d_25C 7d_15C 0.911439 no
5d_25C 7d_30C 0.383092 no
5d_25C 10d_25C 0.048261 yes
7d_25C 7d_15C 0.518676 no
7d_25C 7d_30C 0.118691 no
7d_25C 10d_25C 0.208472 no
7d_15C 7d_30C 0.499832 no
7d_15C 10d_25C 0.027948 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g393.t1
MGKGTDKLYITHSEWASADAFSASAGAGVSKAKKGGPHAAFKRLPFNFCSLSLQPFSHPVCTPTGTLFDLTNILP
WIKKHGTNPVDGAPLKSSDLIKLTLAKNEDGDYVDPVTYKILTDNTHIVALRNTGNVFSWDTVERLNIKGKLWRD
LVTDEEFSRKDIITLQDPQNIESRNLSSFNYIKEGETGILEGQPTSGSVNTSALGSSAKILKAKEAVAKARSERA
QQAGSAAIGSKVGSKTVAANVASKGQTGKPTPYNAARFTTGKAAASFTSTGLTPHTSAELAVLSEEEYMLKRGRV
KAKAYARIVTTAGHLNLELYPEHAPKAVWNFLQLAKKGYYNDIPFHRNIKGFMLQGGDPTGTGRGGESIWGKYFA
DEFEGPLKHDSRGTLSMANKGKNTNSSQFFIAYRALPHLNLKHTIFGRLIDDPTPSSTTLNKLEIHPVETTTNRP
TPDIRIKEITVFVDPFEDFLAQKRAEEARATGATGPSAEEEEEISRRADDDRVTWTGKRVRGSEADSNDGGVSGV
GKYLKAALEDRDGQEEDEIVEFLDEEIAPEPARKKAKVSGGFGNFSSW*
Coding >Pro_DTO377G3_2|g393.t1
ATGGGAAAAGGAACCGATAAGCTTTATATCACACACTCCGAGTGGGCATCTGCAGATGCTTTCTCGGCCAGTGCT
GGCGCTGGAGTTTCCAAGGCCAAGAAGGGCGGCCCCCACGCCGCGTTCAAGCGCTTGCCGTTCAATTTCTGTTCC
CTTTCCCTCCAACCATTTTCACACCCGGTTTGCACGCCTACAGGAACACTATTCGACCTCACAAACATTCTGCCA
TGGATCAAGAAGCATGGGACCAATCCTGTCGATGGGGCCCCATTGAAGAGCTCGGACTTGATTAAGTTGACTCTC
GCGAAGAACGAGGATGGTGACTACGTCGATCCGGTGACCTACAAGATTCTGACCGATAATACACATATCGTCGCA
TTACGGAATACAGGGAATGTCTTTTCCTGGGATACGGTGGAGCGACTCAACATCAAGGGAAAATTGTGGCGCGAC
TTGGTCACGGATGAGGAATTCAGCCGAAAAGATATTATCACCTTGCAGGACCCGCAGAACATCGAGTCGCGCAAC
CTCAGCTCGTTCAACTACATCAAGGAGGGGGAGACAGGAATCTTGGAAGGCCAACCGACCTCTGGGAGCGTCAAC
ACCAGTGCACTCGGCAGCTCGGCGAAGATTCTGAAAGCGAAAGAGGCAGTTGCAAAGGCACGGTCAGAACGTGCT
CAGCAGGCTGGTTCTGCTGCGATTGGCTCGAAAGTGGGTTCGAAGACTGTAGCTGCGAATGTAGCTTCTAAGGGG
CAAACGGGAAAGCCAACACCCTACAACGCTGCACGATTCACTACGGGCAAGGCGGCTGCGTCGTTTACTAGCACC
GGGCTGACGCCACACACGTCTGCCGAGCTAGCGGTACTATCGGAGGAGGAATACATGCTCAAGCGTGGCCGCGTG
AAGGCCAAGGCTTACGCGCGCATTGTGACCACCGCCGGGCATCTCAATCTGGAGTTGTATCCCGAGCATGCGCCC
AAAGCCGTGTGGAACTTCCTTCAGTTGGCCAAGAAGGGCTATTACAACGATATACCATTTCACCGTAATATCAAG
GGCTTCATGCTCCAGGGTGGTGATCCAACTGGTACTGGACGAGGTGGCGAGAGTATTTGGGGCAAATACTTTGCC
GATGAATTTGAAGGGCCTTTGAAGCACGATTCCCGAGGCACGCTGAGCATGGCCAACAAAGGCAAAAACACAAAT
AGTAGTCAATTCTTCATCGCCTATCGAGCCCTACCTCATCTCAACCTCAAGCACACCATCTTCGGCCGTCTAATC
GACGACCCAACGCCTTCGTCCACTACTTTGAATAAGCTAGAGATCCACCCAGTGGAAACAACTACGAATCGCCCT
ACCCCCGATATTCGTATCAAGGAAATAACGGTCTTTGTAGATCCGTTCGAGGACTTCCTGGCCCAGAAGCGCGCC
GAAGAGGCGCGGGCCACAGGTGCCACGGGTCCTTCTGCAGAAGAGGAAGAGGAGATTTCTCGCCGTGCGGACGAT
GATCGAGTCACCTGGACTGGAAAGCGGGTCCGCGGTTCTGAGGCGGACTCAAATGATGGCGGTGTCTCGGGAGTT
GGAAAGTATCTGAAGGCAGCACTGGAAGACCGGGATGGACAGGAAGAAGATGAGATTGTAGAGTTTCTGGACGAG
GAGATTGCACCTGAGCCCGCTCGCAAAAAGGCCAAGGTGTCTGGAGGCTTTGGAAACTTTAGTTCATGGTAA
Transcript >Pro_DTO377G3_2|g393.t1
ATGGGAAAAGGAACCGATAAGCTTTATATCACACACTCCGAGTGGGCATCTGCAGATGCTTTCTCGGCCAGTGCT
GGCGCTGGAGTTTCCAAGGCCAAGAAGGGCGGCCCCCACGCCGCGTTCAAGCGCTTGCCGTTCAATTTCTGTTCC
CTTTCCCTCCAACCATTTTCACACCCGGTTTGCACGCCTACAGGAACACTATTCGACCTCACAAACATTCTGCCA
TGGATCAAGAAGCATGGGACCAATCCTGTCGATGGGGCCCCATTGAAGAGCTCGGACTTGATTAAGTTGACTCTC
GCGAAGAACGAGGATGGTGACTACGTCGATCCGGTGACCTACAAGATTCTGACCGATAATACACATATCGTCGCA
TTACGGAATACAGGGAATGTCTTTTCCTGGGATACGGTGGAGCGACTCAACATCAAGGGAAAATTGTGGCGCGAC
TTGGTCACGGATGAGGAATTCAGCCGAAAAGATATTATCACCTTGCAGGACCCGCAGAACATCGAGTCGCGCAAC
CTCAGCTCGTTCAACTACATCAAGGAGGGGGAGACAGGAATCTTGGAAGGCCAACCGACCTCTGGGAGCGTCAAC
ACCAGTGCACTCGGCAGCTCGGCGAAGATTCTGAAAGCGAAAGAGGCAGTTGCAAAGGCACGGTCAGAACGTGCT
CAGCAGGCTGGTTCTGCTGCGATTGGCTCGAAAGTGGGTTCGAAGACTGTAGCTGCGAATGTAGCTTCTAAGGGG
CAAACGGGAAAGCCAACACCCTACAACGCTGCACGATTCACTACGGGCAAGGCGGCTGCGTCGTTTACTAGCACC
GGGCTGACGCCACACACGTCTGCCGAGCTAGCGGTACTATCGGAGGAGGAATACATGCTCAAGCGTGGCCGCGTG
AAGGCCAAGGCTTACGCGCGCATTGTGACCACCGCCGGGCATCTCAATCTGGAGTTGTATCCCGAGCATGCGCCC
AAAGCCGTGTGGAACTTCCTTCAGTTGGCCAAGAAGGGCTATTACAACGATATACCATTTCACCGTAATATCAAG
GGCTTCATGCTCCAGGGTGGTGATCCAACTGGTACTGGACGAGGTGGCGAGAGTATTTGGGGCAAATACTTTGCC
GATGAATTTGAAGGGCCTTTGAAGCACGATTCCCGAGGCACGCTGAGCATGGCCAACAAAGGCAAAAACACAAAT
AGTAGTCAATTCTTCATCGCCTATCGAGCCCTACCTCATCTCAACCTCAAGCACACCATCTTCGGCCGTCTAATC
GACGACCCAACGCCTTCGTCCACTACTTTGAATAAGCTAGAGATCCACCCAGTGGAAACAACTACGAATCGCCCT
ACCCCCGATATTCGTATCAAGGAAATAACGGTCTTTGTAGATCCGTTCGAGGACTTCCTGGCCCAGAAGCGCGCC
GAAGAGGCGCGGGCCACAGGTGCCACGGGTCCTTCTGCAGAAGAGGAAGAGGAGATTTCTCGCCGTGCGGACGAT
GATCGAGTCACCTGGACTGGAAAGCGGGTCCGCGGTTCTGAGGCGGACTCAAATGATGGCGGTGTCTCGGGAGTT
GGAAAGTATCTGAAGGCAGCACTGGAAGACCGGGATGGACAGGAAGAAGATGAGATTGTAGAGTTTCTGGACGAG
GAGATTGCACCTGAGCCCGCTCGCAAAAAGGCCAAGGTGTCTGGAGGCTTTGGAAACTTTAGTTCATGGTAA
Gene >Pro_DTO377G3_2|g393.t1
ATGGGAAAAGGTATGTCGTGTGTGAGGGCTTTTTTGTACAATTTCACTAACGCTGTTGACTATAGGAACCGATAA
GCTTTATGTACGCGACATTTTCCTCTACATTCCAATACTCGCATCTTGAATCCCCGCTGATAATTGTACTCTCTC
TAGATCACACACTCCGAGTGGGCATCTGCAGATGCTTTCTCGGCCAGTGCTGGCGCTGGAGTTTCCAAGGCCAAG
AAGGGCGGCCCCCACGCCGCGTTCAAGCGCTTGCCGTTCAATTTCTGTTCCCTTTCCCTCCAACCATTTTCACAC
CCGGTTTGCACGCCTACAGGAACACTATTCGACCTCACAAACATTCTGCCATGGATCAAGAAGCATGGGACCAAT
CCTGTCGATGGGGCCCCATTGAAGAGCTCGGACTTGATTAAGTTGACTCTCGCGAAGAACGAGGATGGTGACTAC
GTCGATCCGGTGACCTACAAGATTCTGACCGATAATACACATATCGTCGCATTACGGAATACAGGGAATGTCTTT
TCCTGGGATACGGTGGAGCGACTCAACATCAAGGGAAAATTGTGGCGCGACTTGGTCACGGATGAGGAATTCAGC
CGAAAAGATATTATCACCTTGCAGGACCCGCAGAACATCGAGTCGCGCAACCTCAGCTCGTTCAACTACATCAAG
GAGGGGGAGACAGGAATCTTGGAAGGCCAACCGACCTCTGGGAGCGTCAACACCAGTGCACTCGGCAGCTCGGCG
AAGATTCTGAAAGCGAAAGAGGCAGTTGCAAAGGCACGGTCAGAACGTGCTCAGCAGGCTGGTTCTGCTGCGATT
GGCTCGAAAGTGGGTTCGAAGACTGTAGCTGCGAATGTAGCTTCTAAGGGGCAAACGGGAAAGCCAACACCCTAC
AACGCTGCACGATTCACTACGGGCAAGGCGGCTGCGTCGTTTACTAGCACCGGGCTGACGCCACACACGTCTGCC
GAGCTAGCGGTACTATCGGAGGAGGAATACATGCTCAAGCGTGGCCGCGTGAAGGCCAAGGCTTACGCGCGCATT
GTGACCACCGCCGGGCATCTCAATCTGGAGTTGTATCCCGAGCATGCGCCCAAAGCCGTGTGGAACTTCCTTCAG
TTGGCCAAGAAGGGCTATTACAACGATATACCATTTCACCGTAATATCAAGGGCTTCATGCTCCAGGGTGGTGAT
CCAACTGGTACTGGACGAGGTGGCGAGAGTATTTGGGGCAAATACTTTGCCGATGAATTTGAAGGGCCTTTGAAG
CACGATTCCCGAGGCACGCTGAGCATGGCCAACAAAGGCAAAAACACAAATAGTAGTCAATTGTAAGTGGCCCCT
TGCGATTACCCCTGGCTCAATGAGTGCGCTAACATGTGCTTTCAGCTTCATCGCCTATCGAGCCCTACCTCATCT
CAACCTCAAGCACACCATCTTCGGCCGTCTAATCGACGACCCAACGCCTTCGTCCACTACTTTGAATAAGCTAGA
GATCCACCCAGTGGAAACAACTACGAATCGCCCTACCCCCGATATTCGTATCAAGGAAATAACGGTCTTTGTAGA
TCCGTTCGAGGACTTCCTGGCCCAGAAGCGCGCCGAAGAGGCGCGGGCCACAGGTGCCACGGGTCCTTCTGCAGA
AGAGGAAGAGGAGATTTCTCGCCGTGCGGACGATGATCGAGTCACCTGGACTGGAAAGCGGGTCCGCGGTTCTGA
GGCGGACTCAAATGATGGCGGTGTCTCGGGAGTTGGAAAGTATCTGAAGGCAGCACTGGAAGACCGGGATGGACA
GGAAGAAGATGAGATTGTAGAGTTTCTGGACGAGGAGATTGCACCTGAGCCCGCTCGCAAAAAGGCCAAGGTGTC
TGGAGGCTTTGGAAACTTTAGTTCATGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail