Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3920.t1
Gene name
Locationscaffold_07:268431..269433
Strand+
Gene length (bp)1002
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01920 Prefoldin_2 Prefoldin subunit 7.2E-23 84 188

GO

GO Term Description Terminal node
GO:0016272 prefoldin complex Yes
GO:0051082 unfolded protein binding Yes
GO:0006457 protein folding Yes
GO:0005515 protein binding No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3920.t1
MYGCLLILCNLYILLPPTQTRYQTRKPTNPQRGQNKSQTRKNKQIPKPNQITTHQTAKMVQPRMLTKADETSAND
ENEVRREDQEKINRFSRLHQRETVLQEELKGKQKDKEDLEEVSMELELADEDELVPYKIGDSFFQLPLSDAQGML
STSTEKIDADVSKLEDSLGELREEMQQLKVALYARFGRSINLET*
Coding >Pro_DTO377G3_2|g3920.t1
ATGTATGGATGCCTATTAATACTCTGCAACCTATATATTCTACTACCACCCACTCAAACCCGATATCAAACGCGC
AAACCAACCAACCCGCAACGAGGACAGAACAAATCCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAA
ATAACCACCCACCAGACAGCCAAAATGGTGCAGCCGCGTATGCTCACAAAAGCGGACGAGACATCAGCCAATGAT
GAGAATGAAGTCCGTCGCGAGGATCAGGAGAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTT
CAGGAGGAGTTGAAGGGGAAGCAGAAGGATAAGGAAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGAT
GAAGATGAGCTTGTGCCCTACAAAATCGGCGACTCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTC
TCGACATCAACAGAGAAGATCGATGCAGATGTTTCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATG
CAGCAGCTGAAGGTTGCACTCTATGCGCGGTTTGGTCGGAGCATTAACCTGGAGACTTGA
Transcript >Pro_DTO377G3_2|g3920.t1
ATGTATGGATGCCTATTAATACTCTGCAACCTATATATTCTACTACCACCCACTCAAACCCGATATCAAACGCGC
AAACCAACCAACCCGCAACGAGGACAGAACAAATCCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAA
ATAACCACCCACCAGACAGCCAAAATGGTGCAGCCGCGTATGCTCACAAAAGCGGACGAGACATCAGCCAATGAT
GAGAATGAAGTCCGTCGCGAGGATCAGGAGAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTT
CAGGAGGAGTTGAAGGGGAAGCAGAAGGATAAGGAAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGAT
GAAGATGAGCTTGTGCCCTACAAAATCGGCGACTCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTC
TCGACATCAACAGAGAAGATCGATGCAGATGTTTCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATG
CAGCAGCTGAAGGTTGCACTCTATGCGCGGTTTGGTCGGAGCATTAACCTGGAGACTTGA
Gene >Pro_DTO377G3_2|g3920.t1
ATGTATGGATGTAAAGAAGATAGAAGCAAAATAGAAGAACCGATATATCCGAAAAAGAAGCCTACATAAGGCCTA
TTAATACTCTGCAACCTATATATTCTACTGTATAGATCCCTATCCCTACAAACACCAACCTCATCCAGCTCATCG
CCACGCACAGACCACCCACTCAAACCCGATATCAAACGCGCAAACCAACCAACCCGCAACGAGGACAGAACAAAT
CCCAGACACGAAAGAACAAACAAATCCCAAAGCCCAACCAAATAACCACCCACCAGACAGCCAAAATGGTGCAGC
CGCGTATGGTAAGCCCAACCCCCACCAAGCTCAAACGCGACAAACCCCACCAAAGCCCAGCTCGCAAGCTAATCG
GATCAACGCGCAGCTCACAAAAGCGGACGAGACATCAGCCAATGATGAGAATGAAGTCCGTCGCGAGGATCAGGA
GAAGATCAACCGGTTCAGTCGGTTGCATCAGCGCGAGACCGTGCTTCAGGAGGAGTTGAAGGGGAAGCAGGTATG
GACTTTGGACTTTTGAGGATTTTGTTCTCTGCCATGTATCGGATCTCTTGCTAACTGGTTTATAGAAGGATAAGG
AAGATTTGGAAGAGGTTTCGATGGAGTTGGAGCTTGCTGATGAAGATGAGCTTGTGCCGTAAGGAATACCTTTCC
CATCTATTCTTGCTTTTGTTTTTTTCGATCATGTTCTGTTGTGGCTTTTCTCTGTGATTCTCATCTCGGAGTATT
ACGAAGAAACCTAAAAAAGAGCAAGAACAGGAAGAAGCCATCACTAACAACCTTCACAGCTACAAAATCGGCGAC
TCATTCTTCCAACTACCGCTATCAGACGCGCAGGGAATGCTCTCGACATCAACAGAGAAGATCGATGCAGATGTT
TCTAAGCTAGAGGACTCGCTTGGTGAGCTGCGTGAGGAAATGCAGCAGCTGAAGGTTGCACTCTATGCGCGGTTT
GGTCGGAGCATTAACCTGGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail