Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3918.t1
Gene name
Locationscaffold_07:262611..264639
Strand-
Gene length (bp)2028
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07676 PD40 WD40-like Beta Propeller Repeat 2.4E-08 77 114
PF07676 PD40 WD40-like Beta Propeller Repeat 3.9E-02 125 159
PF07676 PD40 WD40-like Beta Propeller Repeat 2.3E-07 187 209
PF07676 PD40 WD40-like Beta Propeller Repeat 6.9E-04 342 362
PF07676 PD40 WD40-like Beta Propeller Repeat 2.3E-02 446 458
PF07676 PD40 WD40-like Beta Propeller Repeat 1.8E-01 504 519
PF07676 PD40 WD40-like Beta Propeller Repeat 2.5E-05 550 571

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3918.t1
MHFPASIALLGLALPSALALCPYAEQMNLEKRNTPSPHAHEPRKAASSDKKGIFYMNRIAPGTSELYVANVDGTD
ERPLLSNSIYEYHATFSPDGEWITFTGERNGDGNSDIYRVRTNGSDLEELVATSSVEDGAVVSPNGKQVAYVSTA
NGYKANIWVLDLESGKKWNLTDTVSTAANTSLPDGYFRPSWSPDGQWIAFSSDRNTGWYGHGDPIFQGVTGWEHT
QELSIYAIRPNGSDFRPVVSKSGYCLGSPKWSPDGERIVYYEMTRENTWNAHRPESLNSANSSIVSVEFATGANR
RVEAEGTGVKLFPQYLPNGTIAYAGKGSGIEGLHTTAGGYVNTTSEIIRSPAWSPDGKKVVYEKNAWTIRPMDKK
LYSWDTEWEYRFTDVFPQLSSTNKIALTEKQLGNSSIVSFNANGTDESLVYNDMESDFIDASSVAKGTAGAFNPA
WSPDGKWVSFGVGFWFQGRATGGGWLVRATANGSYSEVLSESTTTLSSNSSVINSGFPSFSHDGKKIVFRIWGTN
STLGDRSQLGLRVLDLETRKTTVLTNEWDNLPSFSPDGKRIVFTRKTSDYNYDICTMRPDGTDVKVLTSSGANDA
HAIWTWDGRIAYSSGMFGFQYECALYDQTFQPYGQVVVMNADGSNKRVLTDSIWEDSMPLYVPNSALKANAKVHK
*
Coding >Pro_DTO377G3_2|g3918.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTACGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG
Transcript >Pro_DTO377G3_2|g3918.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTACGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG
Gene >Pro_DTO377G3_2|g3918.t1
ATGCATTTTCCCGCTTCAATTGCCCTGCTGGGCCTTGCCTTGCCGTCGGCTTTGGCTCTTTGCCCATATGCAGAG
CAGATGAACCTTGAGAAGAGGAACACGCCCTCTCCGCATGCGCACGAACCGCGCAAGGCGGCGTCGTCTGACAAG
AAGGGAATCTTCTACATGAACCGCATTGCTCCCGGGACATCAGAGCTTTATGTTGCCAATGTTGATGGCACTGAT
GAACGTCCTCTCCTCTCCAACTCTATCTATGAATACCATGCCACCTTTTCCCCCGATGGAGAATGGATCACCTTC
ACCGGAGAGCGCAATGGTGACGGTAATTCGGATATCTACCGCGTCCGGACCAACGGGTCTGACCTTGAGGAGTTG
GTAGCAACCTCCTCGGTGGAAGACGGAGCTGTCGTGTCTCCGAATGGAAAGCAAGTCGCCTATGTGTCCACTGCC
AATGGTTACAAGGCCAACATCTGGGTCCTGGATCTGGAGAGTGGCAAGAAATGGAACCTCACAGATACCGTCTCG
ACTGCCGCCAATACTTCTCTTCCTGATGGCTATTTCCGCCCTTCGTGGTCTCCCGACGGCCAATGGATTGCTTTC
TCGTCGGACCGTAACACTGGCTGGTACGGACACGGAGACCCCATCTTCCAAGGTGTCACCGGCTGGGAACATACA
CAGGAGCTGTCCATCTATGCTATCCGCCCCAATGGATCTGATTTCCGTCCCGTCGTGTCGAAGTCTGGTTACTGT
CTTGGTTCGCCCAAGTGGTCTCCCGATGGCGAGCGTATTGTTTACTACGAGATGACTCGTGAGAACACCTGGAAC
GCTCACCGTCCTGAGTCACTCAACTCTGCCAACTCCAGCATTGTCTCCGTGGAGTTTGCCACAGGCGCTAACCGT
CGCGTGGAAGCCGAGGGAACTGGCGTGAAGCTCTTCCCTCAATATCTCCCCAACGGCACTATCGCCTACGCCGGC
AAGGGTTCCGGTATCGAAGGACTCCACACCACTGCCGGTGGATACGTGAACACCACTAGCGAGATTATCCGCTCT
CCTGCCTGGTCTCCAGATGGCAAGAAGGTCGTCTATGAGAAGAACGCCTGGACTATCCGTCCTATGGACAAGAAG
TTGTACAGCTGGGACACGGAGTGGGAATATCGCTTCACCGACGTCTTCCCCCAGTTGTCCAGCACCAACAAGATC
GCTCTGACTGAGAAGCAGCTTGGAAACTCCTCCATTGTTTCCTTCAACGCCAACGGAACCGACGAGAGCCTAGTC
TACAATGACATGGAATCCGACTTCATTGACGCGTCGTCCGTCGCCAAGGGCACCGCAGGCGCCTTCAACCCGGCC
TGGTCGCCCGATGGCAAGTGGGTCTCCTTCGGAGTCGGCTTCTGGTTCCAAGGCCGCGCCACCGGCGGCGGCTGG
CTTGTACGAGCCACTGCCAATGGCTCGTACTCCGAAGTCCTGTCCGAGAGCACCACAACCCTCAGCAGCAACAGC
AGCGTGATCAACTCCGGCTTCCCCAGCTTCTCGCACGACGGCAAGAAGATCGTCTTCCGCATTTGGGGAACAAAC
TCCACCCTGGGCGACAGATCCCAGCTCGGACTCCGTGTTCTGGATCTGGAGACCCGTAAGACCACTGTCTTGACC
AATGAGTGGGATAACCTGCCTTCCTTCTCCCCCGATGGAAAGAGAATCGTCTTTACCCGCAAGACCAGTGATTAC
AACTACGATATCTGCACTATGCGTCCTGATGGAACTGATGTCAAGGTTCTCACTAGCAGTGGTGCCAATGATGCT
CATGCCATCTGGACTTGGGATGGTCGCATTGCCTACTCTTCCGGCATGTTCGGCTTCCAGTACGAGTGTGCTCTC
TATGATCAGACTTTCCAGCCTTATGGTCAGGTCGTCGTTATGAATGCCGATGGCTCGAATAAGCGTGTGCTTACT
GATTCGATCTGGGAGGACTCGATGCCTCTCTATGTGCCGAACAGTGCCCTCAAGGCTAACGCCAAGGTCCACAAA
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail