Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3910.t1
Gene name
Locationscaffold_07:236127..236974
Strand+
Gene length (bp)847
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP EXPERA (EXPanded EBP superfamily) 8.9E-22 94 207

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 61 83 22
3 117 139 22
4 146 168 22
5 183 205 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 29.25 12.81 45.68
5d_25C Five days - 25 degrees Celsius 22.94 9.33 36.56
7d_25C Seven days - 25 degrees Celsius 23.91 9.64 38.18
10d_25C Ten days - 25 degrees Celsius 23.07 9.82 36.32
7d_15C Seven days - 15 degrees Celsius 20.20 7.62 32.78
7d_30C Seven days - 30 degrees Celsius 27.85 12.18 43.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.534572 no
3d_25C 7d_25C 0.620054 no
3d_25C 7d_15C 0.305142 no
3d_25C 7d_30C 0.918731 no
3d_25C 10d_25C 0.528301 no
5d_25C 7d_25C 0.938579 no
5d_25C 7d_15C 0.793857 no
5d_25C 7d_30C 0.647161 no
5d_25C 10d_25C 0.991238 no
7d_25C 7d_15C 0.713337 no
7d_25C 7d_30C 0.733869 no
7d_25C 10d_25C 0.946247 no
7d_15C 7d_30C 0.400460 no
7d_15C 10d_25C 0.775471 no
7d_30C 10d_25C 0.646785 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3910.t1
MPSPPSHPYYPLDADVVGYQPNQTPVMELLVSAGGACTVLLGVTFALARYVKPTLRVADRIAILWFVLSGTLHCF
FEGYFMIHHAHMASAQDLFGQLWKEYALSDSRYMTSDTLVLCMETMTVLLWGPLCFVVAYLTVIGHSLRHPIQVI
VCMSHLYGDMLYYATSLFDEYVHGRPYSRPEPYYFWLYYFLMNFIWIVVPAYYLYQSISTISAALKRQSEKDKTN
*
Coding >Pro_DTO377G3_2|g3910.t1
ATGCCCAGTCCTCCATCTCATCCATATTACCCCTTGGATGCCGATGTTGTGGGTTATCAGCCCAACCAGACCCCG
GTGATGGAGCTTCTCGTCTCTGCTGGTGGGGCCTGTACTGTCCTTCTTGGTGTGACTTTCGCATTGGCCAGATAT
GTGAAACCCACACTGCGCGTGGCGGATCGAATCGCCATCCTGTGGTTTGTGCTCTCTGGAACTCTGCACTGCTTC
TTCGAGGGTTATTTTATGATCCATCATGCCCACATGGCTTCTGCCCAAGATCTCTTTGGGCAACTATGGAAAGAA
TACGCTCTGTCGGATTCCCGGTATATGACTTCGGACACATTGGTGTTATGTATGGAGACCATGACCGTGCTCCTG
TGGGGACCACTGTGCTTTGTTGTTGCATACTTGACCGTAATCGGCCATTCCCTGCGCCACCCCATCCAGGTAATT
GTGTGCATGAGCCATCTGTACGGCGACATGCTATATTATGCGACCAGTTTGTTTGACGAGTATGTCCACGGGCGA
CCATATTCCCGACCGGAGCCGTATTATTTTTGGCTATATTACTTCCTCATGAACTTCATCTGGATTGTGGTCCCA
GCGTACTATCTCTACCAAAGTATCTCCACAATCTCGGCCGCACTTAAACGCCAGTCGGAAAAGGACAAGACTAAC
TAG
Transcript >Pro_DTO377G3_2|g3910.t1
ATGCCCAGTCCTCCATCTCATCCATATTACCCCTTGGATGCCGATGTTGTGGGTTATCAGCCCAACCAGACCCCG
GTGATGGAGCTTCTCGTCTCTGCTGGTGGGGCCTGTACTGTCCTTCTTGGTGTGACTTTCGCATTGGCCAGATAT
GTGAAACCCACACTGCGCGTGGCGGATCGAATCGCCATCCTGTGGTTTGTGCTCTCTGGAACTCTGCACTGCTTC
TTCGAGGGTTATTTTATGATCCATCATGCCCACATGGCTTCTGCCCAAGATCTCTTTGGGCAACTATGGAAAGAA
TACGCTCTGTCGGATTCCCGGTATATGACTTCGGACACATTGGTGTTATGTATGGAGACCATGACCGTGCTCCTG
TGGGGACCACTGTGCTTTGTTGTTGCATACTTGACCGTAATCGGCCATTCCCTGCGCCACCCCATCCAGGTAATT
GTGTGCATGAGCCATCTGTACGGCGACATGCTATATTATGCGACCAGTTTGTTTGACGAGTATGTCCACGGGCGA
CCATATTCCCGACCGGAGCCGTATTATTTTTGGCTATATTACTTCCTCATGAACTTCATCTGGATTGTGGTCCCA
GCGTACTATCTCTACCAAAGTATCTCCACAATCTCGGCCGCACTTAAACGCCAGTCGGAAAAGGACAAGACTAAC
TAG
Gene >Pro_DTO377G3_2|g3910.t1
ATGCCCAGTCCTCCATCTCATCCATATTACCCCTTGGATGCCGATGTTGTGGGTTATCAGCCCAACCAGACCCCG
GTGATGGAGCTTCTCGTCTCTGCTGGTGGGGCCTGTACTGTCCTTCTTGGTGTGACTTTCGCATTGGCCAGATAT
GTGAAACCCACACTGCGCGTGGCGGATCGAATCGCCATCCTGTGGTTTGTGCTCTGTAAGGCGCCAAGATAAATA
TCAGCTTGGAGGTTGAACACTGACAATGGGGATCTATAGCTGGAACTCTGCACTGCTTCTTCGAGGGTTATTTTA
TGATCCATCATGCCCACATGGCTTCTGCCCAAGATCTCTTTGGGCAACTATGGAAAGAATACGCTCTGTCGGATT
CCCGGTATATGACTTCGGACACATTGGTGTTATGTATGGAGACCATGACCGTGGTGAGTCCCACAGCTATATACA
ACGCCGACGCTAGGATTCACCGCTGATTCCCACCAAGCTCCTGTGGGGACCACTGTGCTTTGTTGTTGCATACTT
GACCGTAATCGGCCATTCCCTGCGCCACCCCATCCAGGTAATTGTGTGCATGAGCCATCTGTACGGCGACATGCT
ATATTATGCGACCAGTTTGTTTGACGAGTATGTCCACGGGCGACCATATTCCCGACCGGAGCCGTATTATTTTTG
GCTATATTACTTCCTCATGAACTTCATCTGGATTGTGGTCCCAGCGTGTATGCCCTACAGTCCCCGGGATGTCTG
TTATAGGCTGACTTGGTTAATAGACTATCTCTACCAAAGTATCTCCACAATCTCGGCCGCACTTAAACGCCAGTC
GGAAAAGGACAAGACTAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail