Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3904.t1
Gene name
Locationscaffold_07:219440..221439
Strand-
Gene length (bp)1999
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04261 Dyp_perox Dyp-type peroxidase family 1.2E-07 337 435

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016209 antioxidant activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3904.t1
MSLTSAIKANIQGDVWPGLPKRFQSFLFFRVRNQVDFKNRLKTFIPKITTGQDACEMGETIKRAKKEAELAKKSA
KLQGLPGINIAFTSTGLEALGAFVNSNDQTFVKKDRQLSTVFRKQQLRGGLFEKGMYADLVGEGWDNPQELRKEY
KPTDDNERLIDGVIMVTASLKRDLDTTVSEVKQHFLAEEGVPLNPDTYVLSQNPSIEFTLVREGKVRPGAMKGKE
HFGFKDGISQPVIEGWDERQPVGKEPKATKSGLIVCGHEGDPMGQPAWAKDGSFLVFRDLQQLVPEFDEFMEENA
MHAPFTQDHPKPAEKLAAYLMGRWKNGTPVDESPHDDSDEKLFSSNNFDYHPVEEHKKCPFAAHTRKMRPRADLE
HDHAVIIRRGIPYGEEVSAEEMTDRKSSEEKERGLLFVCYQSDIRNGFNFLTTRWASNHHFPDRKTHFVGGDGPG
IDAFVGQRLDHHPPRSIGLPDGKYPTEARMPLESWVIQRGGEYFFVPSISTLKNELTGPGIFDQEKLARLREDNA
*
Coding >Pro_DTO377G3_2|g3904.t1
ATGAGTCTCACATCAGCCATCAAGGCAAATATCCAAGGAGATGTTTGGCCGGGTCTCCCAAAAAGGTTTCAAAGC
TTTCTCTTTTTTCGCGTTCGAAACCAAGTTGATTTCAAGAACCGACTGAAGACATTTATTCCCAAGATTACCACC
GGGCAAGATGCCTGTGAGATGGGTGAGACCATCAAGCGGGCAAAGAAGGAGGCCGAACTGGCAAAAAAATCAGCT
AAGCTTCAAGGTTTACCGGGAATCAACATTGCCTTTACCTCGACCGGTCTTGAAGCACTTGGAGCATTTGTGAAT
TCCAATGATCAGACTTTCGTCAAAAAAGACAGGCAACTATCAACAGTCTTCCGGAAGCAACAACTCCGTGGTGGA
TTGTTCGAAAAGGGCATGTATGCGGATCTTGTCGGCGAGGGGTGGGATAACCCCCAGGAGCTTCGAAAGGAATAC
AAGCCCACCGATGATAATGAGAGACTCATTGATGGTGTGATTATGGTGACCGCAAGCCTGAAGCGTGATTTGGAT
ACCACGGTCAGCGAGGTGAAGCAACATTTCCTGGCCGAGGAGGGAGTACCTCTCAACCCAGATACATATGTACTC
AGCCAGAACCCTTCTATAGAGTTCACACTGGTCAGAGAAGGAAAGGTTCGCCCAGGCGCTATGAAGGGAAAAGAG
CATTTCGGATTCAAGGATGGAATCAGTCAGCCTGTAATTGAGGGCTGGGATGAAAGGCAACCCGTGGGAAAGGAG
CCCAAGGCCACAAAGTCAGGATTGATTGTTTGCGGACATGAGGGCGACCCTATGGGCCAACCAGCATGGGCCAAA
GATGGCAGTTTCCTTGTTTTCCGCGACCTTCAACAACTTGTTCCTGAATTTGACGAGTTCATGGAGGAAAACGCT
ATGCACGCCCCTTTTACTCAAGACCACCCCAAGCCAGCCGAAAAGCTTGCTGCATACTTGATGGGAAGATGGAAG
AACGGAACCCCCGTGGATGAGTCTCCTCATGATGACTCTGACGAGAAACTCTTCTCATCAAACAACTTCGATTAC
CACCCCGTTGAGGAGCACAAAAAGTGCCCCTTTGCGGCACACACCCGCAAAATGAGACCACGGGCTGACTTGGAG
CACGACCATGCTGTTATTATCCGTCGTGGCATTCCGTATGGCGAGGAAGTCTCGGCTGAAGAAATGACTGACCGA
AAGTCCTCTGAGGAAAAGGAACGTGGGCTTCTGTTCGTCTGCTACCAGAGCGATATCCGCAATGGATTCAACTTC
CTGACTACCCGCTGGGCAAGCAATCACCACTTCCCTGACCGCAAGACTCACTTCGTCGGTGGTGATGGTCCGGGC
ATTGATGCGTTTGTAGGCCAGAGACTAGACCATCACCCGCCTCGCTCTATCGGTCTTCCTGATGGCAAATATCCC
ACCGAGGCCCGCATGCCGCTAGAGAGCTGGGTTATCCAAAGAGGAGGAGAATACTTCTTCGTGCCTTCTATCTCA
ACGTTGAAGAACGAACTCACGGGTCCTGGTATCTTTGACCAGGAGAAACTGGCGCGTCTCCGTGAAGATAACGCG
TAA
Transcript >Pro_DTO377G3_2|g3904.t1
ATGAGTCTCACATCAGCCATCAAGGCAAATATCCAAGGAGATGTTTGGCCGGGTCTCCCAAAAAGGTTTCAAAGC
TTTCTCTTTTTTCGCGTTCGAAACCAAGTTGATTTCAAGAACCGACTGAAGACATTTATTCCCAAGATTACCACC
GGGCAAGATGCCTGTGAGATGGGTGAGACCATCAAGCGGGCAAAGAAGGAGGCCGAACTGGCAAAAAAATCAGCT
AAGCTTCAAGGTTTACCGGGAATCAACATTGCCTTTACCTCGACCGGTCTTGAAGCACTTGGAGCATTTGTGAAT
TCCAATGATCAGACTTTCGTCAAAAAAGACAGGCAACTATCAACAGTCTTCCGGAAGCAACAACTCCGTGGTGGA
TTGTTCGAAAAGGGCATGTATGCGGATCTTGTCGGCGAGGGGTGGGATAACCCCCAGGAGCTTCGAAAGGAATAC
AAGCCCACCGATGATAATGAGAGACTCATTGATGGTGTGATTATGGTGACCGCAAGCCTGAAGCGTGATTTGGAT
ACCACGGTCAGCGAGGTGAAGCAACATTTCCTGGCCGAGGAGGGAGTACCTCTCAACCCAGATACATATGTACTC
AGCCAGAACCCTTCTATAGAGTTCACACTGGTCAGAGAAGGAAAGGTTCGCCCAGGCGCTATGAAGGGAAAAGAG
CATTTCGGATTCAAGGATGGAATCAGTCAGCCTGTAATTGAGGGCTGGGATGAAAGGCAACCCGTGGGAAAGGAG
CCCAAGGCCACAAAGTCAGGATTGATTGTTTGCGGACATGAGGGCGACCCTATGGGCCAACCAGCATGGGCCAAA
GATGGCAGTTTCCTTGTTTTCCGCGACCTTCAACAACTTGTTCCTGAATTTGACGAGTTCATGGAGGAAAACGCT
ATGCACGCCCCTTTTACTCAAGACCACCCCAAGCCAGCCGAAAAGCTTGCTGCATACTTGATGGGAAGATGGAAG
AACGGAACCCCCGTGGATGAGTCTCCTCATGATGACTCTGACGAGAAACTCTTCTCATCAAACAACTTCGATTAC
CACCCCGTTGAGGAGCACAAAAAGTGCCCCTTTGCGGCACACACCCGCAAAATGAGACCACGGGCTGACTTGGAG
CACGACCATGCTGTTATTATCCGTCGTGGCATTCCGTATGGCGAGGAAGTCTCGGCTGAAGAAATGACTGACCGA
AAGTCCTCTGAGGAAAAGGAACGTGGGCTTCTGTTCGTCTGCTACCAGAGCGATATCCGCAATGGATTCAACTTC
CTGACTACCCGCTGGGCAAGCAATCACCACTTCCCTGACCGCAAGACTCACTTCGTCGGTGGTGATGGTCCGGGC
ATTGATGCGTTTGTAGGCCAGAGACTAGACCATCACCCGCCTCGCTCTATCGGTCTTCCTGATGGCAAATATCCC
ACCGAGGCCCGCATGCCGCTAGAGAGCTGGGTTATCCAAAGAGGAGGAGAATACTTCTTCGTGCCTTCTATCTCA
ACGTTGAAGAACGAACTCACGGGTCCTGGTATCTTTGACCAGGAGAAACTGGCGCGTCTCCGTGAAGATAACGCG
TAA
Gene >Pro_DTO377G3_2|g3904.t1
ATGAGTCTCACATCAGCCATCAAGGCAAATATCCAAGGAGATGTTTGGTGAGTTTTCCATGCTACCGAGTATTCA
TATCGGCATGGTCTTTCAAAATACTTACCTTCATCAGGCCGGGTCTCCCAAAAAGGTTTCAAAGCTTTCTCTTTT
TTCGCGTTCGAAACCAAGTTGATTTCAAGAACCGACTGAAGACATTTATTCCCAAGATTACCACCGGGCAAGATG
CCTGTGAGATGGGTGAGACCATCAAGCGGGCAAAGAAGGAGGCCGAACTGGCAAAAAAATCAGCTAAGCTTCAAG
GTTTACCGGGAATCAACATTGCCTTTACCTCGACCGGTCTTGAAGCAGTAAGTTATCAATCCAACTGTTGTCACT
GAGATTGAACAAATACTGATAAGCCACCACTCATAGCTTGGAGCATTTGTGAATTCCAATGATCAGACTTTCGTC
AAAAAAGACAGGCAACTATCAACAGTCTTCCGGAAGCAACAACTCCGTGGTGGATTGTTCGAAAAGGGCATGTAT
GCGGATCTTGTCGGCGAGGGGTGGGATAACCCCCAGGAGCTTCGAAAGGAATACAAGCCCACCGATGATAATGAG
AGACTCATTGATGGTGTGATTATGGTGACCGCAAGCCTGAAGCGTGATTTGGATACCACGGTCAGCGAGGTGAAG
CAACATTTCCTGGCCGAGGAGGGAGTACCTCTCAACCCAGATACATATGTACTCAGCCAGAACCCTTCTATAGAG
TTCACACTGGTCAGAGAAGGAAAGGTTCGCCCAGGCGCTATGAAGGGAAAAGAGCAGTAAGTACTTATCAACCTC
AGGAGTCTTTGCCGGCCAAACTTACCTTTATATTCAGTTTCGGATTCAAGGATGGAATCAGTCAGCCTGTAATTG
AGGGCTGGGATGAAAGGCAACCCGTGGGAAAGGAGCCCAAGGCCACAAAGTCAGGGTAAATGTGCTCGCCGTTGT
TGAATGAAGGACTCTCAGACTGATGAAATGCAGATTGATTGTTTGCGGACATGAGGGCGACCCTATGGGCCAACC
AGCATGGGCCAAAGATGGCAGTTTCCTTGTTTTCCGCGACCTTCAACAACTTGTTCCTGAATTTGACGAGTGGGT
GACCTCTTCTTATTGTATTGTTTGCTATTTGGTATTGATCAAGTCTATAGGTTCATGGAGGAAAACGCTATGCAC
GCCCCTTTTACTCAAGACCACCCCAAGCCAGCCGAAAAGCTTGCTGCATACTTGATGGGAAGATGGAAGAACGGT
TCGTCGCAAATTAGAATCTTTGAAGTTCGCGCAACGATTTGCTGACCAATATCAAGGAACCCCCGTGGATGAGTC
TCCTCATGATGACTCTGACGAGAAACTCTTCTCATCAAACAACTTCGATTACCACCCCGTTGAGGAGCACAAAAA
GTGCCCCTTTGCGGCACACACCCGCAAAATGAGACCACGGGCTGACTTGGAGCACGACCATGCTGTTATTATCCG
TCGTGGCATTCCGTATGGCGAGGAAGTCTCGGCTGAAGAAATGACTGACCGAAAGTCCTCTGAGGAAAAGGAACG
TGGGCTTCTGTTCGTCTGCTACCAGAGCGATATCCGCAATGGATTCAACTTCCTGACTACCCGTAAGCAGTCGAA
ACTTGAACTCATGCATGTGTGACAAAGAGCCCCCCACTAACAATTGATTCTCCTAGGCTGGGCAAGCAATCACCA
CTTCCCTGACCGCAAGACTCACTTCGTCGGTGGTGATGGTCCGGGCATTGATGCGTTTGTAGGCCAGAGACTAGA
CCATCACCCGCCTCGCTCTATCGGTCTTCCTGATGGCAAATATCCCACCGAGGCCCGCATGCCGCTAGAGAGCTG
GGTTATCCAAAGAGGAGGAGAATACTTCTTCGTGCCTTCTATCTCAACGTTGAAGAACGAACTCACGGGTCCTGG
TATCTTTGACCAGGAGAAACTGGCGCGTCTCCGTGAAGATAACGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail