Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3879.t1
Gene name
Locationscaffold_07:156315..156991
Strand-
Gene length (bp)676
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 673.56 406.53 940.60
5d_25C Five days - 25 degrees Celsius 225.21 131.33 319.10
7d_25C Seven days - 25 degrees Celsius 239.70 135.82 343.59
10d_25C Ten days - 25 degrees Celsius 52.52 20.87 84.17
7d_15C Seven days - 15 degrees Celsius 271.83 152.74 390.92
7d_30C Seven days - 30 degrees Celsius 38.31 15.84 60.78

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.855090 no
5d_25C 7d_15C 0.486462 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.683125 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.388847 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3879.t1
MHSFTTHLSLLFAASATLIAAQDATSQSTSGNSNCASQKVVDSCVAIMKRGLAKCASNDWDCKCSGAANIANCYV
DCSDDDPDSFAAKQLSVNDCATANAYDQGETTVAPSWTLPGSNAAQPTDTDATLTTSSSSSTTAGPTKTFANEKS
TSPSEGAAVVNDAGSWMALVVLGLGAAF*
Coding >Pro_DTO377G3_2|g3879.t1
ATGCATTCTTTTACTACTCATCTCTCCCTTCTATTTGCTGCATCGGCTACCCTTATCGCCGCTCAAGATGCCACA
TCCCAAAGCACAAGCGGCAACTCGAACTGTGCTTCTCAAAAAGTTGTAGATTCATGCGTTGCGATAATGAAACGT
GGACTCGCAAAGTGTGCCTCGAATGATTGGGACTGCAAGTGCTCGGGGGCTGCAAACATTGCCAACTGTTACGTA
GATTGCTCCGATGATGACCCGGATTCGTTCGCGGCCAAACAACTGAGTGTAAATGATTGCGCTACCGCAAATGCA
TACGACCAAGGAGAGACTACCGTCGCACCCTCGTGGACTCTTCCTGGATCAAATGCGGCACAGCCAACCGACACA
GATGCTACTTTGACCACTAGTAGCAGCTCGTCTACTACTGCCGGACCGACTAAAACCTTTGCGAATGAGAAGTCG
ACGAGTCCATCAGAGGGAGCTGCGGTTGTGAATGATGCTGGTAGTTGGATGGCTCTTGTGGTTCTAGGGCTAGGG
GCTGCATTTTGA
Transcript >Pro_DTO377G3_2|g3879.t1
ATGCATTCTTTTACTACTCATCTCTCCCTTCTATTTGCTGCATCGGCTACCCTTATCGCCGCTCAAGATGCCACA
TCCCAAAGCACAAGCGGCAACTCGAACTGTGCTTCTCAAAAAGTTGTAGATTCATGCGTTGCGATAATGAAACGT
GGACTCGCAAAGTGTGCCTCGAATGATTGGGACTGCAAGTGCTCGGGGGCTGCAAACATTGCCAACTGTTACGTA
GATTGCTCCGATGATGACCCGGATTCGTTCGCGGCCAAACAACTGAGTGTAAATGATTGCGCTACCGCAAATGCA
TACGACCAAGGAGAGACTACCGTCGCACCCTCGTGGACTCTTCCTGGATCAAATGCGGCACAGCCAACCGACACA
GATGCTACTTTGACCACTAGTAGCAGCTCGTCTACTACTGCCGGACCGACTAAAACCTTTGCGAATGAGAAGTCG
ACGAGTCCATCAGAGGGAGCTGCGGTTGTGAATGATGCTGGTAGTTGGATGGCTCTTGTGGTTCTAGGGCTAGGG
GCTGCATTTTGA
Gene >Pro_DTO377G3_2|g3879.t1
ATGCATTCTTTTACTACTCATCTCTCCCTTCTATTTGCTGCATCGGCTACCCTTATCGCCGCTCAAGATGCCACA
TCCCAAAGCACAAGCGGCAACTCGAACTGTGCTTCTCAAAAGTAAGCTCATAAGCCTATGAAATTCTGTTGAGAT
TCCTTTCTCATAATCAACAGAGTTGTAGATTCATGCGTTGCGATAATGAAACGTGGACTCGCAAAGTGTGCCTCG
AATGATTGGGACTGCAAGTGCTCGGGGGCTGCAAACATTGCCAAGTAAGTAGGCCACCTACTTGACTCTCGTAAT
TCCTCAATGAGATGTCTATACACTCAACACCGCAGTACTGATATAATCGAGCAGCTGTTACGTAGATTGCTCCGA
TGATGACCCGGATTCGTTCGCGGCCAAACAACTGAGTGTAAATGATTGCGCTACCGCAAATGCATACGACCAAGG
AGAGACTACCGTCGCACCCTCGTGGACTCTTCCTGGATCAAATGCGGCACAGCCAACCGACACAGATGCTACTTT
GACCACTAGTAGCAGCTCGTCTACTACTGCCGGACCGACTAAAACCTTTGCGAATGAGAAGTCGACGAGTCCATC
AGAGGGAGCTGCGGTTGTGAATGATGCTGGTAGTTGGATGGCTCTTGTGGTTCTAGGGCTAGGGGCTGCATTTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail