Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3876.t1
Gene name
Locationscaffold_07:151583..152754
Strand+
Gene length (bp)1171
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05859 Mis12 Mis12 protein 1.9E-46 8 161

GO

GO Term Description Terminal node
GO:0000278 mitotic cell cycle Yes
GO:0000775 chromosome, centromeric region Yes
GO:0005634 nucleus Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0098687 chromosomal region No
GO:0043226 organelle No
GO:0044464 cell part No
GO:0044446 intracellular organelle part No
GO:0007049 cell cycle No
GO:0043227 membrane-bounded organelle No
GO:0044422 organelle part No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0044427 chromosomal part No
GO:0044424 intracellular part No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3876.t1
MDDATTSLLTEHFSYTPLSLIDDIINSINNLIYQAISSLESGLLNTPPERLGFSHDSSGPSIAETDEDGNVVYPE
AKLEIENGLHQLETLLETNVDKAFDKFEIYVLRNILTVPGDLLSWVRLKHYEGLSFVSSPDTPTPETIHAQRKKL
FETKKLNRSLKEERARNDAVISQLQSILSTVETAKVDGVSKTAEDIPVDLSFLTSSPAARQLRVGVDAGSNAKPT
PLTTNTTFILSQLPALQTTLEQLRPKLAALPNATVQIEAKSKRDERKEYIESRIRLHLERAGQLAVGDDGNPVVA
GRRIDIREAHALESVANMLTQDKSV*
Coding >Pro_DTO377G3_2|g3876.t1
ATGGATGATGCAACGACCTCCTTGCTCACTGAGCACTTTAGTTACACACCCTTGTCTCTTATAGATGACATTATC
AACTCGATCAACAATCTGATTTACCAGGCGATATCTAGCTTGGAGTCCGGCCTCCTCAATACGCCACCTGAACGG
CTCGGTTTCTCCCATGACAGCAGTGGCCCCAGCATCGCGGAAACAGACGAGGATGGCAATGTGGTTTATCCCGAG
GCGAAGCTAGAGATCGAGAATGGATTGCATCAGCTAGAGACGCTGCTGGAGACCAATGTTGATAAGGCCTTCGAC
AAATTTGAGATCTATGTGCTGCGTAACATTCTCACGGTGCCCGGAGACTTGCTCTCTTGGGTGCGGTTGAAGCAC
TACGAGGGTCTCTCTTTCGTATCTTCGCCAGACACACCGACGCCAGAAACCATACATGCGCAACGCAAGAAGTTG
TTCGAGACAAAGAAACTAAACCGGTCGCTAAAAGAAGAACGCGCTCGAAATGATGCGGTCATATCACAGCTACAA
TCTATCTTGTCGACAGTTGAAACAGCGAAGGTAGATGGTGTGTCCAAGACAGCGGAAGACATACCAGTGGATCTG
TCCTTCTTGACCTCTAGCCCAGCTGCACGCCAGCTTCGTGTTGGTGTCGATGCTGGGTCGAATGCTAAACCCACA
CCTCTTACAACCAACACTACTTTCATTCTCTCGCAGCTGCCCGCGTTGCAGACGACACTTGAACAGCTCCGACCG
AAATTGGCAGCCCTGCCCAATGCAACGGTACAAATTGAAGCCAAGTCTAAGAGAGATGAGAGAAAGGAATATATC
GAGAGCAGAATTCGACTCCATCTCGAGCGAGCTGGTCAGCTTGCTGTGGGTGATGATGGAAATCCAGTGGTCGCA
GGTCGCAGAATCGACATCAGAGAGGCCCACGCCCTTGAAAGCGTGGCAAACATGCTTACGCAAGACAAATCTGTG
TAA
Transcript >Pro_DTO377G3_2|g3876.t1
ATGGATGATGCAACGACCTCCTTGCTCACTGAGCACTTTAGTTACACACCCTTGTCTCTTATAGATGACATTATC
AACTCGATCAACAATCTGATTTACCAGGCGATATCTAGCTTGGAGTCCGGCCTCCTCAATACGCCACCTGAACGG
CTCGGTTTCTCCCATGACAGCAGTGGCCCCAGCATCGCGGAAACAGACGAGGATGGCAATGTGGTTTATCCCGAG
GCGAAGCTAGAGATCGAGAATGGATTGCATCAGCTAGAGACGCTGCTGGAGACCAATGTTGATAAGGCCTTCGAC
AAATTTGAGATCTATGTGCTGCGTAACATTCTCACGGTGCCCGGAGACTTGCTCTCTTGGGTGCGGTTGAAGCAC
TACGAGGGTCTCTCTTTCGTATCTTCGCCAGACACACCGACGCCAGAAACCATACATGCGCAACGCAAGAAGTTG
TTCGAGACAAAGAAACTAAACCGGTCGCTAAAAGAAGAACGCGCTCGAAATGATGCGGTCATATCACAGCTACAA
TCTATCTTGTCGACAGTTGAAACAGCGAAGGTAGATGGTGTGTCCAAGACAGCGGAAGACATACCAGTGGATCTG
TCCTTCTTGACCTCTAGCCCAGCTGCACGCCAGCTTCGTGTTGGTGTCGATGCTGGGTCGAATGCTAAACCCACA
CCTCTTACAACCAACACTACTTTCATTCTCTCGCAGCTGCCCGCGTTGCAGACGACACTTGAACAGCTCCGACCG
AAATTGGCAGCCCTGCCCAATGCAACGGTACAAATTGAAGCCAAGTCTAAGAGAGATGAGAGAAAGGAATATATC
GAGAGCAGAATTCGACTCCATCTCGAGCGAGCTGGTCAGCTTGCTGTGGGTGATGATGGAAATCCAGTGGTCGCA
GGTCGCAGAATCGACATCAGAGAGGCCCACGCCCTTGAAAGCGTGGCAAACATGCTTACGCAAGACAAATCTGTG
TAA
Gene >Pro_DTO377G3_2|g3876.t1
ATGGATGATGCAACGACCTCCTTGCTCACTGAGCACTTTAGTTACACACCCTTGGTAAGCCTATCGAGACTGATA
CGCATGGACTCGTGCTGCATGCGCGACCTACGAGTTGCGACTCCGGACCCACCCCTTGCAACTAGGAATATCGCT
GACAGCTCCCTAGTCTCTTATAGATGACATTATCAACTCGATCAACAATCTGATTTACCAGGCGATATCTAGCTT
GGAGTCCGGCCTCCTCAATACGCCACCTGAACGGCTCGGTTTCTCCCATGACAGCAGTGGCCCCAGCATCGCGGA
AACAGACGAGGATGGCAATGTGGTTTATCCCGAGGCGAAGCTAGAGATCGAGAATGGATTGCATCAGCTAGAGAC
GCTGCTGGAGACCAATGTTGATAAGGCCTTCGACAAATTTGAGATCTATGTGCTGCGTAACATTCTCACGGTGCC
CGGAGACTTGCTCTCTTGGGTGCGGTTGAAGCACTACGAGGTATGTGGAGGCTTTCACAGTTGTCTAGACCTGAA
CCTGCTTGCTGTTTTGTAATAAGGGATATACTAATGCGCCTTGTGCTAGGGTCTCTCTTTCGTATCTTCGCCAGA
CACACCGACGCCAGAAACCATACATGCGCAACGCAAGAAGTTGTTCGAGACAAAGAAACTAAACCGGTCGCTAAA
AGAAGAACGCGCTCGAAATGATGCGGTCATATCACAGCTACAATCTATCTTGTCGACAGTTGAAACAGCGAAGGT
AGATGGTGTGTCCAAGACAGCGGAAGACATACCAGTGGATCTGTCCTTCTTGACCTCTAGCCCAGCTGCACGCCA
GCTTCGTGTTGGTGTCGATGCTGGGTCGAATGCTAAACCCACACCTCTTACAACCAACACTACTTTCATTCTCTC
GCAGCTGCCCGCGTTGCAGACGACACTTGAACAGCTCCGACCGAAATTGGCAGCCCTGCCCAATGCAACGGTACA
AATTGAAGCCAAGTCTAAGAGAGATGAGAGAAAGGAATATATCGAGAGCAGAATTCGACTCCATCTCGAGCGAGC
TGGTCAGCTTGCTGTGGGTGATGATGGAAATCCAGTGGTCGCAGGTCGCAGAATCGACATCAGAGAGGCCCACGC
CCTTGAAAGCGTGGCAAACATGCTTACGCAAGACAAATCTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail