Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g386.t1
Gene name
Locationscaffold_01:983062..984376
Strand-
Gene length (bp)1314
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.5E-73 87 394

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.70 1.28 8.13
5d_25C Five days - 25 degrees Celsius 3.86 0.83 6.89
7d_25C Seven days - 25 degrees Celsius 3.02 0.58 5.47
10d_25C Ten days - 25 degrees Celsius 2.03 0.07 3.99
7d_15C Seven days - 15 degrees Celsius 2.82 0.49 5.16
7d_30C Seven days - 30 degrees Celsius 3.63 0.76 6.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.727818 no
3d_25C 7d_25C 0.341623 no
3d_25C 7d_15C 0.262227 no
3d_25C 7d_30C 0.627342 no
3d_25C 10d_25C 0.089066 no
5d_25C 7d_25C 0.657396 no
5d_25C 7d_15C 0.552026 no
5d_25C 7d_30C 0.926425 no
5d_25C 10d_25C 0.219039 no
7d_25C 7d_15C 0.921137 no
7d_25C 7d_30C 0.758099 no
7d_25C 10d_25C 0.486436 no
7d_15C 7d_30C 0.655845 no
7d_15C 10d_25C 0.580477 no
7d_30C 10d_25C 0.283136 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g386.t1
MVVFSQVTVALTCFSAIASAAAVPVKSPRKGFTVNQVQKAVPGTRTVNLPGLYANALVKYGATVPATVHAAAVSG
SAITTPEADDVEYLTPVTIGSSTLNLDFDTGSADLWVFSSELTSSQQSGHDVYNVGSSGTKLSGASWSISYGDGS
SASGDVYKDTVTVGGVKATGQAVEAAKKISSQFLQDKNNDGLLGLAFSSINTVSPTPQKTFFDTVKSSLGEPLFA
VTLKHGAPGTYDFGYIDSDKYTGTLAYADVDDSDGFWSFTADSYKIGTGAAGKSITGIADTGTTLLLLDSSIVTA
YYKKVTGSQNSSSAGGYIFPCSATLPDFTVTINGYDAVVPGKYINFAPVSTGSSSCYGGIQSNSGIGFSIFGDIF
LKSQYVVFDSEGPRLGFAAQA*
Coding >Pro_DTO377G3_2|g386.t1
ATGGTTGTCTTCAGCCAAGTTACCGTCGCTCTCACCTGCTTCTCGGCCATTGCTTCAGCTGCGGCTGTGCCGGTC
AAGAGCCCCCGCAAGGGCTTCACTGTGAACCAGGTGCAGAAGGCTGTTCCCGGTACCAGGACTGTCAACTTGCCT
GGTCTGTACGCCAATGCACTGGTCAAGTATGGTGCTACTGTGCCGGCCACAGTTCACGCTGCTGCCGTGAGCGGT
TCCGCCATTACCACGCCCGAGGCCGACGACGTTGAGTATCTCACTCCAGTCACCATTGGCAGCTCTACCTTGAAC
TTGGACTTCGACACTGGCTCTGCTGACCTCTGGGTCTTCTCTAGCGAGCTTACCTCTTCGCAGCAGTCCGGCCAC
GACGTCTACAACGTTGGCAGCTCCGGCACTAAGCTGTCCGGTGCTAGCTGGTCCATTTCATACGGCGATGGCAGC
AGTGCTAGCGGTGATGTCTACAAGGACACCGTCACTGTTGGTGGAGTCAAGGCCACTGGCCAAGCTGTTGAGGCT
GCCAAGAAGATCAGCTCGCAGTTCCTGCAGGACAAGAACAACGATGGTCTGCTGGGTCTGGCTTTCAGCTCCATC
AACACCGTCAGCCCTACCCCCCAGAAGACCTTCTTCGACACCGTCAAGTCTAGCCTTGGCGAGCCTCTGTTCGCC
GTGACTCTCAAGCACGGCGCCCCTGGCACCTACGACTTCGGCTACATCGACTCGGATAAGTACACCGGAACTTTG
GCCTACGCCGACGTTGATGACTCCGATGGTTTCTGGTCCTTCACTGCCGACAGCTACAAGATCGGCACTGGTGCT
GCTGGCAAGTCTATTACCGGAATTGCTGATACCGGTACCACTCTCCTCCTGCTCGATAGCTCTATTGTCACCGCC
TACTACAAGAAGGTTACCGGCTCCCAGAACAGCAGCTCTGCTGGTGGTTATATCTTCCCTTGCAGCGCCACTCTG
CCTGACTTCACTGTGACCATCAATGGCTACGATGCCGTTGTTCCCGGCAAGTACATCAACTTCGCACCTGTCTCT
ACCGGTAGCTCCAGCTGCTACGGTGGTATCCAGAGCAACTCTGGCATTGGCTTCTCCATCTTCGGTGATATCTTC
CTCAAGAGCCAGTACGTCGTTTTCGACTCCGAGGGACCTCGTCTTGGCTTCGCTGCCCAGGCATAA
Transcript >Pro_DTO377G3_2|g386.t1
ATGGTTGTCTTCAGCCAAGTTACCGTCGCTCTCACCTGCTTCTCGGCCATTGCTTCAGCTGCGGCTGTGCCGGTC
AAGAGCCCCCGCAAGGGCTTCACTGTGAACCAGGTGCAGAAGGCTGTTCCCGGTACCAGGACTGTCAACTTGCCT
GGTCTGTACGCCAATGCACTGGTCAAGTATGGTGCTACTGTGCCGGCCACAGTTCACGCTGCTGCCGTGAGCGGT
TCCGCCATTACCACGCCCGAGGCCGACGACGTTGAGTATCTCACTCCAGTCACCATTGGCAGCTCTACCTTGAAC
TTGGACTTCGACACTGGCTCTGCTGACCTCTGGGTCTTCTCTAGCGAGCTTACCTCTTCGCAGCAGTCCGGCCAC
GACGTCTACAACGTTGGCAGCTCCGGCACTAAGCTGTCCGGTGCTAGCTGGTCCATTTCATACGGCGATGGCAGC
AGTGCTAGCGGTGATGTCTACAAGGACACCGTCACTGTTGGTGGAGTCAAGGCCACTGGCCAAGCTGTTGAGGCT
GCCAAGAAGATCAGCTCGCAGTTCCTGCAGGACAAGAACAACGATGGTCTGCTGGGTCTGGCTTTCAGCTCCATC
AACACCGTCAGCCCTACCCCCCAGAAGACCTTCTTCGACACCGTCAAGTCTAGCCTTGGCGAGCCTCTGTTCGCC
GTGACTCTCAAGCACGGCGCCCCTGGCACCTACGACTTCGGCTACATCGACTCGGATAAGTACACCGGAACTTTG
GCCTACGCCGACGTTGATGACTCCGATGGTTTCTGGTCCTTCACTGCCGACAGCTACAAGATCGGCACTGGTGCT
GCTGGCAAGTCTATTACCGGAATTGCTGATACCGGTACCACTCTCCTCCTGCTCGATAGCTCTATTGTCACCGCC
TACTACAAGAAGGTTACCGGCTCCCAGAACAGCAGCTCTGCTGGTGGTTATATCTTCCCTTGCAGCGCCACTCTG
CCTGACTTCACTGTGACCATCAATGGCTACGATGCCGTTGTTCCCGGCAAGTACATCAACTTCGCACCTGTCTCT
ACCGGTAGCTCCAGCTGCTACGGTGGTATCCAGAGCAACTCTGGCATTGGCTTCTCCATCTTCGGTGATATCTTC
CTCAAGAGCCAGTACGTCGTTTTCGACTCCGAGGGACCTCGTCTTGGCTTCGCTGCCCAGGCATAA
Gene >Pro_DTO377G3_2|g386.t1
ATGGTTGTCTTCAGCCAAGTTACCGTCGCTCTCACCTGCTTCTCGGCCATTGCTTCAGCTGCGGCTGTGCCGGTC
AAGAGCCCCCGCAAGGGCTTCACTGTGAACCAGGTGCAGAAGGCTGTTCCCGGTACCAGGACTGTCAACTTGCCT
GGTCTGTACGCCAATGCACTGGTCAAGTATGGTGCTACTGTGCCGGCCACAGTTCACGCTGCTGCCGTGAGCGGT
TCCGCCATTACCACGCCCGAGGCCGACGACGTTGAGTATCTCACTCCAGTCACCATTGGCAGCTCTACCTTGAAC
TTGGACTTCGACACTGGCTCTGCTGACCTGTAAGTTGGTTGATATGGCATGACTAGCAAGGGCAACAACTGACAA
TTCATATAGCTGGGTCTTCTCTAGCGAGCTTACCTCTTCGCAGCAGTCCGGCCACGACGTCTACAACGTTGGCAG
CTCCGGCACTAAGCTGTCCGGTGCTAGCTGGTCCATTTCATACGGCGATGGCAGCAGTGCTAGCGGTGATGTCTA
CAAGGACACCGTCACTGTTGGTGGAGTCAAGGCCACTGGCCAAGCTGTTGAGGCTGCCAAGAAGATCAGCTCGCA
GTTCCTGCAGGACAAGAACAACGATGGTCTGCTGGGTCTGGCTTTCAGCTCCATCAACACCGTCAGCCCTACCCC
CCAGAAGACCTTCTTCGACACCGTCAAGTCTAGCCTTGGCGAGCCTCTGTTCGCCGTGACTCTCAAGCACGGCGC
CCCTGGCACCTACGACTTCGGCTACATCGACTCGGATAAGTACACCGGAACTTTGGCCTACGCCGACGTTGATGA
CTCCGATGGTTTCTGGTCCTTCACTGCCGACAGCTACAAGATCGGCACTGGTGCTGCTGGCAAGTCTATTACCGG
AATTGCTGGTGAGTTACATTCTCCCTTGTGGACATCCATGCTTTGTTTACCATGACTAATCTCTTGAATTGTATA
GATACCGGTACCACTCTCCTCCTGCTCGATAGCTCTATTGTCACCGCCTACTACAAGAAGGTTACCGGCTCCCAG
AACAGCAGCTCTGCTGGTGGTTATATCTTCCCTTGCAGCGCCACTCTGCCTGACTTCACTGTGACCATCAATGGC
TACGATGCCGTTGTTCCCGGCAAGTACATCAACTTCGCACCTGTCTCTACCGGTAGCTCCAGCTGCTACGGTGGT
ATCCAGAGCAACTCTGGCATTGGCTTCTCCATCTTCGGTGATATCTTCCTCAAGAGCCAGTACGTCGTTTTCGAC
TCCGAGGGACCTCGTCTTGGCTTCGCTGCCCAGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail