Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3854.t1
Gene name
Locationscaffold_07:82313..84032
Strand+
Gene length (bp)1719
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03467 Smg4_UPF3 Smg-4/UPF3 family 4.1E-44 37 205
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.8E-06 415 460

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 33.16 19.12 47.20
5d_25C Five days - 25 degrees Celsius 33.86 19.53 48.20
7d_25C Seven days - 25 degrees Celsius 29.90 16.85 42.95
10d_25C Ten days - 25 degrees Celsius 29.89 16.79 43.00
7d_15C Seven days - 15 degrees Celsius 28.26 15.80 40.71
7d_30C Seven days - 30 degrees Celsius 36.01 20.96 51.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.954401 no
3d_25C 7d_25C 0.745559 no
3d_25C 7d_15C 0.583699 no
3d_25C 7d_30C 0.799436 no
3d_25C 10d_25C 0.747854 no
5d_25C 7d_25C 0.686048 no
5d_25C 7d_15C 0.519287 no
5d_25C 7d_30C 0.858223 no
5d_25C 10d_25C 0.686701 no
7d_25C 7d_15C 0.877189 no
7d_25C 7d_30C 0.511725 no
7d_25C 10d_25C 0.999235 no
7d_15C 7d_30C 0.359339 no
7d_15C 10d_25C 0.876112 no
7d_30C 10d_25C 0.515288 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3854.t1
MQPGKTTAGLLPIPAAATQKSGSGAPARKTPKPPAPRLKLLIRRLPPGLTQAELESALGDQWKAGAGNVDWLQYK
PGKVSKDPNKPSRPSRAYIHVVSTECVSLLSDAVRQASFQDARNTLHDPILLGPPSLEFAPYAKTPGSRSRKDAR
QGTIDQDSDFIAFLESLTQPITRPVAVDSTPDGEDKKKQAVMTTPLVQFIKDKKASKLKDGSGSKSKHSRSDKES
KQEKVQAKKLLQRGDKEPSANSSDKKPKGEKTSKDSVKATKQGAAANAKGGKSSTTSNATKDTAAAPERKRERGN
VTAATKILQRDLGLSTSGGRRRGKGTSTDTASPKNESSRDSAIPSADLSKETTRPPKTASSSTNAPKPKDSESSS
RPDAAPPPPATLPAKSTKAGKSKHPSTAKQAFLKHANPSQGVTEALLQSAFTPFGAVTKVEIDKKKGFGYIDFAE
PEALRKAIAASPVSVAQSQVVVLERKENPGIEKSRKGREGFTANKTKAPTEASGSTSGAGGHVTGGNAGSSRGSR
GGRGSRNKGPKSGASEKTGGTEAE*
Coding >Pro_DTO377G3_2|g3854.t1
ATGCAGCCTGGCAAGACCACCGCCGGTCTACTCCCAATTCCGGCAGCAGCTACGCAAAAGTCGGGCTCTGGAGCG
CCCGCAAGGAAAACGCCTAAGCCTCCTGCTCCACGTCTCAAACTTCTCATTCGACGTTTGCCACCCGGGCTAACA
CAGGCCGAGCTGGAGAGTGCTCTTGGGGACCAGTGGAAGGCTGGAGCAGGGAACGTTGACTGGCTTCAGTACAAA
CCTGGCAAGGTGTCGAAAGACCCCAACAAACCGTCTCGCCCGTCAAGAGCATACATACACGTCGTGTCCACCGAA
TGTGTCTCTTTGCTCTCGGACGCTGTGCGCCAGGCTTCTTTCCAGGATGCCCGTAACACTCTACACGACCCCATT
TTGCTGGGGCCTCCGTCGCTGGAGTTTGCACCTTATGCCAAGACCCCCGGAAGCCGCTCGCGCAAGGATGCTCGT
CAAGGCACGATTGATCAAGATTCAGACTTCATCGCTTTCTTAGAAAGCCTGACCCAGCCCATTACCAGGCCTGTG
GCTGTGGATTCTACACCCGATGGCGAGGACAAGAAGAAGCAAGCCGTAATGACCACCCCGCTGGTACAGTTCATC
AAAGACAAGAAAGCCAGCAAGTTAAAGGACGGCAGTGGGTCCAAATCTAAACACAGTCGGTCGGACAAGGAATCA
AAGCAGGAGAAGGTACAAGCAAAGAAACTTCTACAACGAGGCGATAAGGAACCCTCGGCAAACTCTTCCGACAAG
AAACCCAAAGGAGAAAAGACAAGCAAAGACTCTGTCAAAGCAACCAAACAAGGAGCCGCTGCCAATGCCAAGGGA
GGCAAGTCGAGTACGACATCAAACGCTACAAAGGATACAGCCGCGGCTCCAGAGCGGAAGAGAGAGCGCGGAAAT
GTCACAGCAGCCACCAAGATTCTTCAGCGTGATCTTGGACTATCGACATCTGGTGGGCGACGACGCGGGAAAGGT
ACTTCGACTGATACTGCGTCACCTAAGAACGAGAGCTCTCGAGACTCGGCTATTCCATCAGCCGATCTGTCCAAG
GAAACAACCAGGCCTCCTAAAACCGCATCATCCTCAACCAATGCTCCAAAGCCCAAGGACAGCGAGTCATCCTCG
CGACCCGATGCGGCTCCACCGCCACCTGCAACCTTACCAGCCAAGTCCACTAAAGCTGGCAAATCCAAGCACCCA
TCAACTGCTAAACAAGCATTCCTCAAGCACGCCAATCCATCCCAGGGTGTGACCGAGGCACTTCTGCAGTCTGCA
TTCACCCCATTTGGAGCAGTGACGAAGGTCGAGATTGACAAGAAGAAGGGATTCGGATACATAGATTTTGCTGAA
CCGGAAGCACTTCGCAAGGCCATCGCTGCTAGTCCCGTATCGGTGGCCCAGAGCCAAGTGGTGGTCTTGGAGCGG
AAAGAGAACCCCGGAATCGAAAAGTCTCGGAAGGGACGTGAGGGGTTCACTGCCAACAAGACGAAGGCTCCCACG
GAAGCTTCTGGGAGCACTTCAGGTGCTGGCGGTCATGTAACTGGAGGTAACGCTGGCTCCTCCCGCGGATCTCGT
GGAGGGCGTGGATCACGGAATAAGGGACCCAAGAGTGGAGCTTCAGAGAAAACTGGAGGCACCGAGGCGGAGTGA
Transcript >Pro_DTO377G3_2|g3854.t1
ATGCAGCCTGGCAAGACCACCGCCGGTCTACTCCCAATTCCGGCAGCAGCTACGCAAAAGTCGGGCTCTGGAGCG
CCCGCAAGGAAAACGCCTAAGCCTCCTGCTCCACGTCTCAAACTTCTCATTCGACGTTTGCCACCCGGGCTAACA
CAGGCCGAGCTGGAGAGTGCTCTTGGGGACCAGTGGAAGGCTGGAGCAGGGAACGTTGACTGGCTTCAGTACAAA
CCTGGCAAGGTGTCGAAAGACCCCAACAAACCGTCTCGCCCGTCAAGAGCATACATACACGTCGTGTCCACCGAA
TGTGTCTCTTTGCTCTCGGACGCTGTGCGCCAGGCTTCTTTCCAGGATGCCCGTAACACTCTACACGACCCCATT
TTGCTGGGGCCTCCGTCGCTGGAGTTTGCACCTTATGCCAAGACCCCCGGAAGCCGCTCGCGCAAGGATGCTCGT
CAAGGCACGATTGATCAAGATTCAGACTTCATCGCTTTCTTAGAAAGCCTGACCCAGCCCATTACCAGGCCTGTG
GCTGTGGATTCTACACCCGATGGCGAGGACAAGAAGAAGCAAGCCGTAATGACCACCCCGCTGGTACAGTTCATC
AAAGACAAGAAAGCCAGCAAGTTAAAGGACGGCAGTGGGTCCAAATCTAAACACAGTCGGTCGGACAAGGAATCA
AAGCAGGAGAAGGTACAAGCAAAGAAACTTCTACAACGAGGCGATAAGGAACCCTCGGCAAACTCTTCCGACAAG
AAACCCAAAGGAGAAAAGACAAGCAAAGACTCTGTCAAAGCAACCAAACAAGGAGCCGCTGCCAATGCCAAGGGA
GGCAAGTCGAGTACGACATCAAACGCTACAAAGGATACAGCCGCGGCTCCAGAGCGGAAGAGAGAGCGCGGAAAT
GTCACAGCAGCCACCAAGATTCTTCAGCGTGATCTTGGACTATCGACATCTGGTGGGCGACGACGCGGGAAAGGT
ACTTCGACTGATACTGCGTCACCTAAGAACGAGAGCTCTCGAGACTCGGCTATTCCATCAGCCGATCTGTCCAAG
GAAACAACCAGGCCTCCTAAAACCGCATCATCCTCAACCAATGCTCCAAAGCCCAAGGACAGCGAGTCATCCTCG
CGACCCGATGCGGCTCCACCGCCACCTGCAACCTTACCAGCCAAGTCCACTAAAGCTGGCAAATCCAAGCACCCA
TCAACTGCTAAACAAGCATTCCTCAAGCACGCCAATCCATCCCAGGGTGTGACCGAGGCACTTCTGCAGTCTGCA
TTCACCCCATTTGGAGCAGTGACGAAGGTCGAGATTGACAAGAAGAAGGGATTCGGATACATAGATTTTGCTGAA
CCGGAAGCACTTCGCAAGGCCATCGCTGCTAGTCCCGTATCGGTGGCCCAGAGCCAAGTGGTGGTCTTGGAGCGG
AAAGAGAACCCCGGAATCGAAAAGTCTCGGAAGGGACGTGAGGGGTTCACTGCCAACAAGACGAAGGCTCCCACG
GAAGCTTCTGGGAGCACTTCAGGTGCTGGCGGTCATGTAACTGGAGGTAACGCTGGCTCCTCCCGCGGATCTCGT
GGAGGGCGTGGATCACGGAATAAGGGACCCAAGAGTGGAGCTTCAGAGAAAACTGGAGGCACCGAGGCGGAGTGA
Gene >Pro_DTO377G3_2|g3854.t1
ATGCAGCCTGGCAAGACCACCGCCGGTCTACTCCCAATTCCGGCAGCAGCTACGCAAAAGTCGGGCTCTGGAGCG
CCCGCAAGGAAAACGCCTAAGCCTCCTGCTCCACGTCTCAAACTTCTCATTCGACGTTTGCCACCCGGGCTAACA
CAGGCCGAGCTGGAGAGTGCTCTTGGGGACCAGTGGAAGGCTGGAGCAGGGAACGTTGACTGGCTTCAGTACAAA
CCTGGCAAGGTGTCGAAAGAGTAAGATTCACCTTCCTCTGATGCAAAAGCGTATTTATTTCGACTGGCTGACGGG
ACTTCTTCAAATAGCCCCAACAAACCGTCTCGCCCGTCAAGAGCATACATACACGTCGTGTCCACCGAATGTGTC
TCTTTGCTCTCGGACGCTGTGCGCCAGGCTTCTTTCCAGGATGCCCGTAACACTCTACACGACCCCATTTTGCTG
GGGCCTCCGTCGCTGGAGTTTGCACCTTATGCCAAGACCCCCGGAAGCCGCTCGCGCAAGGATGCTCGTCAAGGC
ACGATTGATCAAGATTCAGACTTCATCGCTTTCTTAGAAAGCCTGACCCAGCCCATTACCAGGCCTGTGGCTGTG
GATTCTACACCCGATGGCGAGGACAAGAAGAAGCAAGCCGTAATGACCACCCCGCTGGTACAGTTCATCAAAGAC
AAGAAAGCCAGCAAGTTAAAGGACGGCAGTGGGTCCAAATCTAAACACAGTCGGTCGGACAAGGAATCAAAGCAG
GAGAAGGTACAAGCAAAGAAACTTCTACAACGAGGCGATAAGGAACCCTCGGCAAACTCTTCCGACAAGAAACCC
AAAGGAGAAAAGACAAGCAAAGACTCTGTCAAAGCAACCAAACAAGGAGCCGCTGCCAATGCCAAGGGAGGCAAG
TCGAGTACGACATCAAACGCTACAAAGGATACAGCCGCGGCTCCAGAGCGGAAGAGAGAGCGCGGAAATGTCACA
GCAGCCACCAAGATTCTTCAGCGTGATCTTGGACTATCGACATCTGGTGGGCGACGACGCGGGAAAGGTACTTCG
ACTGATACTGCGTCACCTAAGAACGAGAGCTCTCGAGACTCGGCTATTCCATCAGCCGATCTGTCCAAGGAAACA
ACCAGGCCTCCTAAAACCGCATCATCCTCAACCAATGCTCCAAAGCCCAAGGACAGCGAGTCATCCTCGCGACCC
GATGCGGCTCCACCGCCACCTGCAACCTTACCAGCCAAGTCCACTAAAGCTGGCAAATCCAAGCACCCATCAACT
GCTAAACAAGCATTCCTCAAGCACGCCAATCCATCCCAGGGTGTGACCGAGGCACTTCTGCAGTCTGCATTCACC
CCATTTGGAGCAGTGACGAAGGTCGAGATTGACAAGAAGAAGGGATTCGGATACATAGATTTTGCTGAACCGGAA
GCACTTCGCAAGGCCATCGCTGCTAGTCCCGTATCGGTGGCCCAGAGCCAAGTGGTGGTCTTGGAGCGGAAAGAG
AACCCCGGAATCGAAAAGTCTCGGAAGGGACGTGAGGGGTTCACTGCCAACAAGACGAAGGCTCCCACGGAAGCT
TCTGGGAGCACTTCAGGTGCTGGCGGTCATGTAACTGGAGGTAACGCTGGCTCCTCCCGCGGATCTCGTGGAGGG
CGTGGATCACGGAATAAGGGACCCAAGAGTGGAGCTTCAGAGAAAACTGGAGGCACCGAGGCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail