Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3836.t1
Gene name
Locationscaffold_07:40146..43374
Strand+
Gene length (bp)3228
Transcript length (bp)2982
Coding sequence length (bp)2982
Protein length (aa) 994

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.3E-34 187 410
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-15 427 693
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.3E-09 89 142

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22
2 150 168 18
3 341 363 22
4 383 405 22
5 738 760 22
6 770 789 19
7 802 824 22
8 866 888 22
9 916 938 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2730.82 1023.96 4437.69
5d_25C Five days - 25 degrees Celsius 1792.58 739.63 2845.53
7d_25C Seven days - 25 degrees Celsius 908.94 415.08 1402.79
10d_25C Ten days - 25 degrees Celsius 626.81 316.96 936.66
7d_15C Seven days - 15 degrees Celsius 2638.66 884.66 4392.65
7d_30C Seven days - 30 degrees Celsius 1052.02 430.72 1673.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.219995 no
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.950798 no
3d_25C 7d_30C 0.001278 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.024892 yes
5d_25C 7d_15C 0.288233 no
5d_25C 7d_30C 0.104487 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.728439 no
7d_25C 10d_25C 0.212099 no
7d_15C 7d_30C 0.004045 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.089334 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3836.t1
MSSVSNPNRDVENDAAERRFSAISYKEDVKIDEYTRLVRWMSTYRDTKWDQADEGEIRESRVWFAPWRKRKFRWK
YIGVGQEFPDDWKFTDINHGLSDSEVEERRKVTGFNELTAEKVDQFRKILGYFQGPILYVMEIAVLLAAGLAEWI
DFGVIIGILCLNAAVGWYQEKQAEDVVASLKADIAMRSTVVRNGTEIDILARDLVPGDVIVIEEANSVPADAKVV
CDYQEKETGWQNYQQMRQEGKLDKKKKKATEDDESSEEDEHKDFPVLACDHSAITGESLAVDRYAGDDVFYTTGC
KRGKAYAIVQSTGIKTFVGRTAAMVQQGGSGTGHFQMVMDGIGTALLVLVMAWILIMWIGGFFRNLPIASPGQQT
LLHFTLSLFIIGVPVGLPVVTTTTLAVGAAYLAKKKAIVQKLTAIESLAGVDILCSDKTGTLTANKLSIQEPYVA
EGVDVNWLFAVAILASSHNVRSLDPIDKVTILSANKYPKAKEILRQPWKTLSFTPFDPVSKRIVSVVTLNGERYT
CTKGAPKAVLQLTNCDESVATLYRQQATDFARRGFRSLGVAVQKGNEPWTLLGMLPMFDPPRDDTAQTILEAQNL
GIAVKMLTGDAIAIAKETCKMLALGTKVYNSERLIGGGLSGAMASELCEKADGFAEVFPEHKYQVVEMLQDIGHL
TAMTGDGVNDAPSLKKADCGIAVEGASEAAQSAADIVFLEPGLSTIIDSIKLARQIFQRMKSYIQYRIALCIHLE
VYLVTSMIIIKESIRTDLVVFLALFADLATVAVAYDNASFERRPVQWQLPKIWVISVILGVLLALGTWVIRATMF
LPNGGFFQNWGSIQEILFLEVALTENWLIFVTRGGNTWPSLPLIIAILGVDALATCFCLFGWFSNQDMITDPFDQ
YINKETSNGFTNVVDVVRCWGYSIGVTVVLALVYFILNKWKWLEDLGRTKKSKGDIAIGTILSHLSTMSLQYEKD
AANHGRIWLGTTKEDEME*
Coding >Pro_DTO377G3_2|g3836.t1
ATGTCGTCTGTATCCAATCCCAACCGCGACGTCGAAAATGACGCTGCGGAGCGCCGATTCTCTGCTATTTCCTAT
AAGGAGGATGTGAAGATCGATGAATACACGCGCCTGGTGCGATGGATGTCCACCTACCGTGATACGAAATGGGAC
CAGGCAGATGAAGGCGAAATTCGCGAGAGTCGCGTGTGGTTTGCGCCATGGCGGAAGAGAAAGTTCCGTTGGAAG
TATATCGGCGTCGGACAGGAGTTCCCCGATGACTGGAAGTTCACCGACATCAATCACGGTCTGTCGGACTCGGAA
GTCGAGGAGAGGCGAAAGGTGACCGGATTCAATGAATTGACGGCGGAGAAAGTCGATCAATTCCGCAAAATCTTG
GGATACTTCCAAGGTCCAATTCTATATGTCATGGAGATTGCAGTTTTGCTCGCTGCCGGTTTGGCCGAATGGATT
GACTTTGGTGTCATCATTGGCATTCTCTGTCTGAACGCTGCAGTCGGATGGTACCAAGAGAAGCAGGCCGAGGAC
GTGGTGGCCAGCCTGAAGGCCGATATTGCAATGCGCAGCACGGTTGTTCGCAATGGAACGGAAATCGATATCTTG
GCCCGCGACCTGGTCCCTGGCGACGTGATTGTCATTGAAGAGGCGAACTCGGTCCCCGCCGATGCCAAAGTGGTC
TGCGACTACCAAGAGAAAGAGACAGGCTGGCAGAATTATCAGCAAATGCGGCAAGAAGGCAAGCTGGACAAGAAG
AAGAAGAAAGCAACTGAGGATGATGAATCGTCGGAAGAGGATGAACACAAGGACTTCCCCGTTCTGGCCTGCGAT
CACTCCGCAATTACTGGAGAGTCTCTCGCTGTGGACCGCTATGCCGGTGACGACGTGTTTTACACGACTGGATGC
AAACGAGGCAAGGCCTATGCCATTGTTCAATCGACTGGAATCAAGACCTTTGTGGGTCGCACAGCGGCGATGGTT
CAACAAGGTGGCTCCGGGACAGGACATTTCCAGATGGTCATGGACGGGATTGGTACGGCTCTTCTGGTGCTTGTG
ATGGCATGGATCTTGATCATGTGGATCGGAGGCTTCTTCCGCAACCTGCCCATTGCCTCTCCCGGTCAACAGACC
CTCCTACACTTTACCCTTTCTCTGTTCATCATTGGTGTGCCCGTCGGGCTGCCTGTTGTCACGACCACCACTCTA
GCCGTCGGTGCGGCTTATTTGGCCAAGAAGAAAGCGATCGTCCAGAAGCTTACGGCAATCGAGTCTTTGGCTGGC
GTGGACATCCTCTGTTCTGATAAAACAGGAACATTGACCGCCAATAAGCTCAGTATCCAGGAGCCATACGTCGCC
GAGGGCGTTGATGTGAACTGGTTATTTGCGGTTGCCATTCTAGCTTCTTCTCACAATGTCCGTTCTTTGGATCCG
ATCGATAAGGTTACAATCTTGTCTGCAAACAAATATCCGAAAGCGAAGGAAATCTTGCGCCAACCGTGGAAAACC
CTAAGCTTCACCCCATTTGATCCAGTGTCGAAGCGGATTGTGTCGGTTGTGACCCTAAATGGCGAGCGGTATACC
TGCACCAAGGGAGCGCCAAAGGCAGTGCTTCAGTTGACAAACTGTGATGAATCGGTAGCCACGTTATATCGACAG
CAGGCGACGGATTTTGCTCGCCGTGGCTTTCGATCACTTGGTGTCGCCGTCCAGAAGGGTAACGAACCATGGACC
TTATTGGGAATGCTACCGATGTTCGATCCGCCCCGGGATGATACCGCTCAGACGATTTTAGAGGCCCAAAATCTT
GGAATCGCAGTTAAGATGCTGACTGGCGACGCGATTGCTATCGCCAAGGAGACTTGCAAAATGCTTGCGTTAGGA
ACGAAAGTCTACAACTCCGAAAGACTCATCGGTGGTGGTCTTAGCGGTGCGATGGCAAGTGAATTATGTGAGAAG
GCGGACGGATTCGCCGAGGTTTTCCCAGAGCACAAATACCAGGTAGTCGAGATGCTACAAGATATTGGTCATCTT
ACAGCTATGACGGGTGACGGTGTCAACGATGCCCCATCGCTGAAGAAAGCCGACTGTGGTATTGCGGTGGAAGGC
GCATCGGAAGCAGCTCAGTCTGCCGCGGACATTGTTTTCCTCGAGCCAGGGCTATCTACTATCATTGATTCTATC
AAGTTGGCGCGTCAAATTTTTCAACGTATGAAATCGTATATTCAGTATCGCATTGCACTCTGCATTCACCTCGAA
GTCTATCTGGTCACTAGCATGATCATTATCAAGGAAAGCATCCGCACTGATTTAGTCGTGTTCCTCGCACTATTT
GCCGACCTTGCGACGGTCGCGGTGGCTTACGACAACGCATCCTTCGAGCGCCGACCTGTCCAATGGCAATTGCCG
AAGATCTGGGTCATCTCTGTCATCCTCGGTGTCCTCTTAGCACTCGGGACGTGGGTGATCCGCGCAACGATGTTC
CTGCCGAACGGTGGATTCTTCCAGAATTGGGGCTCAATCCAAGAGATTTTGTTCTTGGAGGTCGCATTGACGGAA
AACTGGCTCATCTTTGTGACGCGTGGAGGCAACACTTGGCCCTCCCTGCCTCTGATCATTGCTATCCTCGGTGTG
GATGCACTCGCAACTTGCTTCTGTTTGTTTGGGTGGTTCTCGAACCAGGATATGATAACCGATCCCTTTGATCAA
TATATCAATAAGGAGACCAGCAATGGTTTCACAAACGTTGTCGATGTCGTCCGCTGTTGGGGGTACAGCATTGGT
GTGACTGTGGTGCTCGCCCTCGTCTACTTCATCTTGAACAAGTGGAAATGGCTCGAAGACTTGGGTCGCACCAAG
AAGAGCAAAGGCGATATTGCCATTGGAACTATCCTCAGTCACCTGTCCACTATGAGCCTCCAATACGAAAAGGAC
GCGGCGAATCATGGGCGAATTTGGCTCGGCACTACCAAGGAGGATGAGATGGAATAA
Transcript >Pro_DTO377G3_2|g3836.t1
ATGTCGTCTGTATCCAATCCCAACCGCGACGTCGAAAATGACGCTGCGGAGCGCCGATTCTCTGCTATTTCCTAT
AAGGAGGATGTGAAGATCGATGAATACACGCGCCTGGTGCGATGGATGTCCACCTACCGTGATACGAAATGGGAC
CAGGCAGATGAAGGCGAAATTCGCGAGAGTCGCGTGTGGTTTGCGCCATGGCGGAAGAGAAAGTTCCGTTGGAAG
TATATCGGCGTCGGACAGGAGTTCCCCGATGACTGGAAGTTCACCGACATCAATCACGGTCTGTCGGACTCGGAA
GTCGAGGAGAGGCGAAAGGTGACCGGATTCAATGAATTGACGGCGGAGAAAGTCGATCAATTCCGCAAAATCTTG
GGATACTTCCAAGGTCCAATTCTATATGTCATGGAGATTGCAGTTTTGCTCGCTGCCGGTTTGGCCGAATGGATT
GACTTTGGTGTCATCATTGGCATTCTCTGTCTGAACGCTGCAGTCGGATGGTACCAAGAGAAGCAGGCCGAGGAC
GTGGTGGCCAGCCTGAAGGCCGATATTGCAATGCGCAGCACGGTTGTTCGCAATGGAACGGAAATCGATATCTTG
GCCCGCGACCTGGTCCCTGGCGACGTGATTGTCATTGAAGAGGCGAACTCGGTCCCCGCCGATGCCAAAGTGGTC
TGCGACTACCAAGAGAAAGAGACAGGCTGGCAGAATTATCAGCAAATGCGGCAAGAAGGCAAGCTGGACAAGAAG
AAGAAGAAAGCAACTGAGGATGATGAATCGTCGGAAGAGGATGAACACAAGGACTTCCCCGTTCTGGCCTGCGAT
CACTCCGCAATTACTGGAGAGTCTCTCGCTGTGGACCGCTATGCCGGTGACGACGTGTTTTACACGACTGGATGC
AAACGAGGCAAGGCCTATGCCATTGTTCAATCGACTGGAATCAAGACCTTTGTGGGTCGCACAGCGGCGATGGTT
CAACAAGGTGGCTCCGGGACAGGACATTTCCAGATGGTCATGGACGGGATTGGTACGGCTCTTCTGGTGCTTGTG
ATGGCATGGATCTTGATCATGTGGATCGGAGGCTTCTTCCGCAACCTGCCCATTGCCTCTCCCGGTCAACAGACC
CTCCTACACTTTACCCTTTCTCTGTTCATCATTGGTGTGCCCGTCGGGCTGCCTGTTGTCACGACCACCACTCTA
GCCGTCGGTGCGGCTTATTTGGCCAAGAAGAAAGCGATCGTCCAGAAGCTTACGGCAATCGAGTCTTTGGCTGGC
GTGGACATCCTCTGTTCTGATAAAACAGGAACATTGACCGCCAATAAGCTCAGTATCCAGGAGCCATACGTCGCC
GAGGGCGTTGATGTGAACTGGTTATTTGCGGTTGCCATTCTAGCTTCTTCTCACAATGTCCGTTCTTTGGATCCG
ATCGATAAGGTTACAATCTTGTCTGCAAACAAATATCCGAAAGCGAAGGAAATCTTGCGCCAACCGTGGAAAACC
CTAAGCTTCACCCCATTTGATCCAGTGTCGAAGCGGATTGTGTCGGTTGTGACCCTAAATGGCGAGCGGTATACC
TGCACCAAGGGAGCGCCAAAGGCAGTGCTTCAGTTGACAAACTGTGATGAATCGGTAGCCACGTTATATCGACAG
CAGGCGACGGATTTTGCTCGCCGTGGCTTTCGATCACTTGGTGTCGCCGTCCAGAAGGGTAACGAACCATGGACC
TTATTGGGAATGCTACCGATGTTCGATCCGCCCCGGGATGATACCGCTCAGACGATTTTAGAGGCCCAAAATCTT
GGAATCGCAGTTAAGATGCTGACTGGCGACGCGATTGCTATCGCCAAGGAGACTTGCAAAATGCTTGCGTTAGGA
ACGAAAGTCTACAACTCCGAAAGACTCATCGGTGGTGGTCTTAGCGGTGCGATGGCAAGTGAATTATGTGAGAAG
GCGGACGGATTCGCCGAGGTTTTCCCAGAGCACAAATACCAGGTAGTCGAGATGCTACAAGATATTGGTCATCTT
ACAGCTATGACGGGTGACGGTGTCAACGATGCCCCATCGCTGAAGAAAGCCGACTGTGGTATTGCGGTGGAAGGC
GCATCGGAAGCAGCTCAGTCTGCCGCGGACATTGTTTTCCTCGAGCCAGGGCTATCTACTATCATTGATTCTATC
AAGTTGGCGCGTCAAATTTTTCAACGTATGAAATCGTATATTCAGTATCGCATTGCACTCTGCATTCACCTCGAA
GTCTATCTGGTCACTAGCATGATCATTATCAAGGAAAGCATCCGCACTGATTTAGTCGTGTTCCTCGCACTATTT
GCCGACCTTGCGACGGTCGCGGTGGCTTACGACAACGCATCCTTCGAGCGCCGACCTGTCCAATGGCAATTGCCG
AAGATCTGGGTCATCTCTGTCATCCTCGGTGTCCTCTTAGCACTCGGGACGTGGGTGATCCGCGCAACGATGTTC
CTGCCGAACGGTGGATTCTTCCAGAATTGGGGCTCAATCCAAGAGATTTTGTTCTTGGAGGTCGCATTGACGGAA
AACTGGCTCATCTTTGTGACGCGTGGAGGCAACACTTGGCCCTCCCTGCCTCTGATCATTGCTATCCTCGGTGTG
GATGCACTCGCAACTTGCTTCTGTTTGTTTGGGTGGTTCTCGAACCAGGATATGATAACCGATCCCTTTGATCAA
TATATCAATAAGGAGACCAGCAATGGTTTCACAAACGTTGTCGATGTCGTCCGCTGTTGGGGGTACAGCATTGGT
GTGACTGTGGTGCTCGCCCTCGTCTACTTCATCTTGAACAAGTGGAAATGGCTCGAAGACTTGGGTCGCACCAAG
AAGAGCAAAGGCGATATTGCCATTGGAACTATCCTCAGTCACCTGTCCACTATGAGCCTCCAATACGAAAAGGAC
GCGGCGAATCATGGGCGAATTTGGCTCGGCACTACCAAGGAGGATGAGATGGAATAA
Gene >Pro_DTO377G3_2|g3836.t1
ATGTCGTCTGTATCCAATCCCAACCGCGACGTCGAAAATGACGCTGCGGAGCGCCGATTCTCTGCTATTTCCTAT
AAGGAGGATGTGAAGATCGATGAATACACGCGCCTGGTGCGATGGATGTCCACCTACCGTGATACGAAATGGGAC
CAGGCAGATGAAGGCGAAATTCGCGAGAGTCGCGTGTGGTTTGCGCCATGGCGGAAGAGAAAGTTCCGTTGGAAG
TATATCGGCGTCGGACAGGAGTTCCCCGATGACTGGAAGTTCACCGACATCAATCACGGTCTGTCGGACTCGGAA
GTCGAGGAGAGGCGAAAGGTGACCGGATTCAATGAATTGACGGCGGAGAAAGTCGATCAATTCCGCAAAATCTTG
GGATACTTCCAAGGTCCAATTCTATATGGTGAGAGACTATCGCGTCCCCGCCGATTGAACGCAGACAGTGACACA
CTAACCGGACCTCGACAGTCATGGAGATTGCAGTTTTGCTCGCTGCCGGTTTGGCCGAATGGATTGACTTTGGTG
TCATCATTGGCATTCTCTGTCTGAACGCTGCAGTCGGATGGTACCAAGAGAAGCAGGCCGAGGACGTGGTGGCCA
GCCTGAAGGCCGATATTGCAATGCGCAGCACGGTTGTTCGCAATGGAACGGAAATCGATATCTTGGCCCGCGACC
TGGTCCCTGGCGACGTGGTAAGATGAGTTCCCTATCCTCTTGACTATTTACCTCTATTAACACATCTTGTCATAT
TCAGATTGTCATTGAAGAGGCGAACTCGGTCCCCGCCGATGCCAAAGTGGTCTGCGACTACCAAGAGAAAGAGAC
AGGCTGGCAGAATTATCAGCAAATGCGGCAAGAAGGCAAGCTGGACAAGAAGAAGAAGAAAGCAACTGAGGATGA
TGAATCGTCGGAAGAGGATGAACACAAGGACTTCCCCGTTCTGGCCTGCGATCACTCCGCAATTACTGGAGAGTC
TCTCGCTGTGGACCGCTATGCCGGTGACGACGTGTTTTACACGACTGGATGCAAACGAGGCAAGGCCTATGCCAT
TGTTCAATCGACTGGAATCAAGACCTTTGTGGGTCGCACAGCGGCGATGGTTCAACAAGGTGGCTCCGGGACAGG
ACATTTCCAGATGGTCATGGACGGGATTGGTACGGCTCTTCTGGTGCTTGTGATGGCATGGATCTTGATCATGTG
GATCGGAGGCTTCTTCCGCAACCTGCCCATTGCCTCTCCCGGTCAACAGACCCTCCTACACTTTACCCTTTCTCT
GTTCATCATTGGTGTGCCCGTCGGGCTGCCTGTTGTCACGACCACCACTCTAGCCGTCGGTGCGGCTTATTTGGC
CAAGAAGAAAGCGATCGTCCAGAAGCTTACGGCAATCGAGTCTTTGGCTGTAAGTATTCCATCCCGAGTTTCTCT
CACGACCGATTTTCAAGCCGATCACTGACGCCGACTAGGGCGTGGACATCCTCTGTTCTGATAAAACAGGAACAT
TGACCGCCAATAAGCTCAGTATCCAGGAGCCATACGTCGCCGAGGGCGTTGATGTGAACTGGTTATTTGCGGTTG
CCATTCTAGCTTCTTCTCACAATGTCCGTTCTTTGGATCCGATCGATAAGGTTACAATCTTGTCTGCAAACAAAT
ATCCGAAAGCGAAGGAAATCTTGCGCCAACCGTGGAAAACCCTAAGCTTCACCCCATTTGATCCAGTGTCGAAGC
GGATTGTGTCGGTTGTGACCCTAAATGGCGAGCGGTATACCTGCACCAAGGGAGCGCCAAAGGCAGTGCTTCAGT
TGACAAACTGTGATGAATCGGTAGCCACGTTATATCGACAGCAGGCGACGGATTTTGCTCGCCGTGGCTTTCGAT
CACTTGGTGTCGCCGTCCAGAAGGGTAACGAACCATGGACCTTATTGGGAATGCTACCGATGTTCGATCCGCCCC
GGGATGATACCGCTCAGACGATTTTAGAGGCCCAAAATCTTGGAATCGCAGTTAAGATGCTGACTGGCGACGCGA
TTGCTATCGCCAAGGAGACTTGCAAAATGCTTGCGTTAGGAACGAAAGTCTACAACTCCGAAAGACTCATCGGTG
GTGGTCTTAGCGGTGCGATGGCAAGTGAATTATGTGAGAAGGCGGACGGATTCGCCGAGGTTTTCCCAGAGCACA
AATACCAGGTAGTCGAGATGCTACAAGATATTGGTCATCTTACAGCTATGACGGGTGACGGTGTCAACGATGCCC
CATCGCTGAAGAAAGCCGACTGTGGTATTGCGGTGGAAGGCGCATCGGAAGCAGCTCAGTCTGCCGCGGACATTG
TTTTCCTCGAGCCAGGGCTATCTACTATCATTGATTCTATCAAGGTTCGATCCACTCAACTCATCAATTTCTGCA
CATTGATCACTAACTTGCTGCTAGTTGGCGCGTCAAATTTTTCAACGTATGAAATCGTATATTCAGTATCGCATT
GCACTCTGCATTCACCTCGAAGTCTATCTGGTCACTAGCATGATCATTATCAAGGAAAGCATCCGCACTGATTTA
GTCGTGTTCCTCGCACTATTTGCCGACCTTGCGACGGTCGCGGTGGCTTACGACAACGCATCCTTCGAGCGCCGA
CCTGTCCAATGGCAATTGCCGAAGATCTGGGTCATCTCTGTCATCCTCGGTGTCCTCTTAGCACTCGGGACGTGG
GTGATCCGCGCAACGATGTTCCTGCCGAACGGTGGATTCTTCCAGAATTGGGGCTCAATCCAAGAGATTTTGTTC
TTGGAGGTCGCATTGACGGAAAACTGGCTCATCTTTGTGACGCGTGGAGGCAACACTTGGCCCTCCCTGCCTCTG
ATCATTGCTATCCTCGGTGTGGATGCACTCGCAACTTGCTTCTGTTTGTTTGGGTGGTTCTCGAACCAGGATATG
ATAACCGATCCCTTTGATCAATATATCAATAAGGAGACCAGCAATGGTTTCACAAACGTTGTCGATGTCGTCCGC
TGTTGGGGGTACAGCATTGGTGTGACTGTGGTGCTCGCCCTCGTCTACTTCATCTTGAACAAGTGGAAATGGCTC
GAAGACTTGGGTCGCACCAAGAAGAGCAAAGGCGATATTGCCATTGGAACTATCCTCAGTCACCTGTCCACTATG
AGCCTCCAATACGAAAAGGACGCGGCGAATCATGGGCGAATTTGGCTCGGCACTACCAAGGAGGATGAGATGGAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail