Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3800.t1
Gene name
Locationscaffold_06:796662..797970
Strand+
Gene length (bp)1308
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14735 HAUS4 HAUS augmin-like complex subunit 4 3.5E-07 253 365

GO

GO Term Description Terminal node
GO:0070652 HAUS complex Yes
GO:0051225 spindle assembly Yes
GO:0007010 cytoskeleton organization No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0005575 cellular_component No
GO:0016043 cellular component organization No
GO:0000226 microtubule cytoskeleton organization No
GO:0007017 microtubule-based process No
GO:0007051 spindle organization No
GO:0006996 organelle organization No
GO:0005875 microtubule associated complex No
GO:0009987 cellular process No
GO:0032991 protein-containing complex No
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0140694 non-membrane-bounded organelle assembly No
GO:0070925 organelle assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3800.t1
MLPPCDPSILEHNPQFKRLYENLTTSLLNSDASTRAQSASPARTAVVEELKQCQTQNAKKRIKEQMLRQLAFAPD
TNLPAECHDNLAIITLYLETPSSAIEPTTPKPETELKKPDEVLTLLAPDIEAFYANIPAFIQPLSKNISSAVQDL
RALSAVNTDPATAPDADAPTTHANHIARARARDRRVRTSMAPVPLLSSQLQARVRALRHTQLSELPVARRNMAAT
AAEVVAARARVLERTVVTLERAKHGALARATKAKAEHLAVLAQGVEGKLEVTKLEIAATLYTPETLAALARYRQH
LRQTKERLQHRRKMTIQELRDYGDVEVSDPVDIDADEGTFPDIARRYGVLAREIEEVKMEIARLEK*
Coding >Pro_DTO377G3_2|g3800.t1
ATGCTTCCTCCCTGTGACCCCTCAATTCTTGAGCACAATCCTCAATTTAAACGACTATATGAGAATCTAACAACC
TCGCTCCTCAATTCAGATGCCTCAACGCGTGCTCAAAGCGCGAGCCCAGCCCGTACAGCTGTGGTGGAAGAGCTG
AAGCAATGCCAGACTCAAAATGCCAAAAAGCGAATCAAGGAACAAATGCTCCGGCAATTGGCCTTCGCCCCAGAC
ACCAACCTCCCGGCGGAGTGCCACGATAACCTGGCCATAATCACCCTCTACCTAGAGACTCCATCGAGCGCAATC
GAACCCACCACCCCAAAGCCAGAAACCGAACTCAAGAAACCAGACGAAGTACTCACCCTCCTAGCACCGGACATT
GAAGCCTTCTACGCCAACATCCCAGCCTTCATCCAACCACTCTCCAAAAACATCTCATCTGCCGTTCAAGACCTA
CGAGCTCTATCAGCCGTAAACACAGATCCAGCCACCGCGCCCGACGCAGACGCTCCAACCACACACGCGAACCAC
ATCGCACGTGCCCGGGCACGCGATCGCCGAGTCCGGACGTCGATGGCGCCGGTCCCATTGCTCTCGTCACAGCTG
CAGGCGCGGGTACGTGCGCTGCGCCACACACAGCTGTCCGAGCTGCCGGTTGCTCGGCGGAATATGGCTGCTACA
GCTGCGGAGGTTGTTGCTGCGCGGGCGCGGGTTTTGGAGCGCACGGTTGTGACCCTGGAGCGGGCGAAGCATGGG
GCTCTGGCGCGCGCGACGAAAGCCAAGGCAGAGCATTTGGCTGTGCTGGCGCAAGGCGTGGAGGGGAAATTAGAG
GTTACAAAACTGGAGATTGCGGCTACGCTGTATACGCCGGAAACACTCGCTGCTCTTGCTCGGTATAGGCAGCAT
CTCAGGCAGACGAAGGAGCGCCTGCAGCACCGTCGGAAGATGACGATTCAAGAGTTGAGAGATTATGGCGATGTC
GAGGTGTCTGATCCGGTTGATATCGATGCGGATGAAGGGACTTTCCCGGATATTGCTCGTCGCTATGGGGTTTTA
GCGAGGGAGATTGAAGAAGTAAAGATGGAAATTGCACGATTAGAGAAATGA
Transcript >Pro_DTO377G3_2|g3800.t1
ATGCTTCCTCCCTGTGACCCCTCAATTCTTGAGCACAATCCTCAATTTAAACGACTATATGAGAATCTAACAACC
TCGCTCCTCAATTCAGATGCCTCAACGCGTGCTCAAAGCGCGAGCCCAGCCCGTACAGCTGTGGTGGAAGAGCTG
AAGCAATGCCAGACTCAAAATGCCAAAAAGCGAATCAAGGAACAAATGCTCCGGCAATTGGCCTTCGCCCCAGAC
ACCAACCTCCCGGCGGAGTGCCACGATAACCTGGCCATAATCACCCTCTACCTAGAGACTCCATCGAGCGCAATC
GAACCCACCACCCCAAAGCCAGAAACCGAACTCAAGAAACCAGACGAAGTACTCACCCTCCTAGCACCGGACATT
GAAGCCTTCTACGCCAACATCCCAGCCTTCATCCAACCACTCTCCAAAAACATCTCATCTGCCGTTCAAGACCTA
CGAGCTCTATCAGCCGTAAACACAGATCCAGCCACCGCGCCCGACGCAGACGCTCCAACCACACACGCGAACCAC
ATCGCACGTGCCCGGGCACGCGATCGCCGAGTCCGGACGTCGATGGCGCCGGTCCCATTGCTCTCGTCACAGCTG
CAGGCGCGGGTACGTGCGCTGCGCCACACACAGCTGTCCGAGCTGCCGGTTGCTCGGCGGAATATGGCTGCTACA
GCTGCGGAGGTTGTTGCTGCGCGGGCGCGGGTTTTGGAGCGCACGGTTGTGACCCTGGAGCGGGCGAAGCATGGG
GCTCTGGCGCGCGCGACGAAAGCCAAGGCAGAGCATTTGGCTGTGCTGGCGCAAGGCGTGGAGGGGAAATTAGAG
GTTACAAAACTGGAGATTGCGGCTACGCTGTATACGCCGGAAACACTCGCTGCTCTTGCTCGGTATAGGCAGCAT
CTCAGGCAGACGAAGGAGCGCCTGCAGCACCGTCGGAAGATGACGATTCAAGAGTTGAGAGATTATGGCGATGTC
GAGGTGTCTGATCCGGTTGATATCGATGCGGATGAAGGGACTTTCCCGGATATTGCTCGTCGCTATGGGGTTTTA
GCGAGGGAGATTGAAGAAGTAAAGATGGAAATTGCACGATTAGAGAAATGA
Gene >Pro_DTO377G3_2|g3800.t1
ATGCTTCCTCCCTGTGACCCCTCAATTCTTGAGCACAATCCTCAATTTAAACGACTATATGAGAATCTAACAACC
TCGCTCCTCAATTCAGATGCCTCAACGCGTGCTCAAAGCGCGAGCCCAGCCCGTACAGCTGTGGTGGAAGTAAGT
GGTCGACGCGCTATGCAGCACATACCTAACGGACTTAAGCACGAACAGAGCTCTGACGACACTATCATTAGGAGC
TGAAGCAATGCCAGACTCAAAATGCCAAAAAGCGAATCAAGGAACAAATGCTCCGGCAATTGGCCTTCGCCCCAG
ACACCAACCTCCCGGCGGAGGTCAGTACAACCCCCACCAAGAAGAAACCACATCCCTAACAAACATACCAAATCT
AGTGCCACGATAACCTGGCCATAATCACCCTCTACCTAGAGACTCCATCGAGCGCAATCGAACCCACCACCCCAA
AGCCAGAAACCGAACTCAAGAAACCAGACGAAGTACTCACCCTCCTAGCACCGGACATTGAAGCCTTCTACGCCA
ACATCCCAGCCTTCATCCAACCACTCTCCAAAAACATCTCATCTGCCGTTCAAGACCTACGAGCTCTATCAGCCG
TAAACACAGATCCAGCCACCGCGCCCGACGCAGACGCTCCAACCACACACGCGAACCACATCGCACGTGCCCGGG
CACGCGATCGCCGAGTCCGGACGTCGATGGCGCCGGTCCCATTGCTCTCGTCACAGCTGCAGGCGCGGGTACGTG
CGCTGCGCCACACACAGCTGTCCGAGCTGCCGGTTGCTCGGCGGAATATGGCTGCTACAGCTGCGGAGGTTGTTG
CTGCGCGGGCGCGGGTTTTGGAGCGCACGGTTGTGACCCTGGAGCGGGCGAAGCATGGGGCTCTGGCGCGCGCGA
CGAAAGCCAAGGCAGAGCATTTGGCTGTGCTGGCGCAAGGCGTGGAGGGGAAATTAGAGTAAGTTCTGCCTTTCC
AGCTTTCAAGTCTTGCTGTTGTCTTTCTGGTGGAGTTTGTTTAATGATTTCGACAGGGTTACAAAACTGGAGATT
GCGGCTACGCTGTATACGCCGGAAACACTCGCTGCTCTTGCTCGGTATAGGCAGCATCTCAGGCAGACGAAGGAG
CGCCTGCAGCACCGTCGGAAGATGACGATTCAAGAGTTGAGAGATTATGGCGATGTCGAGGTGTCTGATCCGGTT
GATATCGATGCGGATGAAGGGACTTTCCCGGATATTGCTCGTCGCTATGGGGTTTTAGCGAGGGAGATTGAAGAA
GTAAAGATGGAAATTGCACGATTAGAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail