Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3786.t1
Gene name
Locationscaffold_06:762075..763062
Strand-
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13373 Dsc3_C DSC E3 ubiquitin ligase complex subunit 3, C-terminal domain 8.7E-44 192 325
PF10302 Dsc3_N DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain 1.8E-35 20 129

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 279 296 17
2 308 327 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 35.32 18.08 52.56
5d_25C Five days - 25 degrees Celsius 39.45 20.78 58.12
7d_25C Seven days - 25 degrees Celsius 34.16 17.39 50.93
10d_25C Ten days - 25 degrees Celsius 45.87 24.98 66.76
7d_15C Seven days - 15 degrees Celsius 30.86 15.31 46.42
7d_30C Seven days - 30 degrees Celsius 68.63 39.88 97.39

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.761657 no
3d_25C 7d_25C 0.940172 no
3d_25C 7d_15C 0.709620 no
3d_25C 7d_30C 0.004840 yes
3d_25C 10d_25C 0.375003 no
5d_25C 7d_25C 0.668150 no
5d_25C 7d_15C 0.420801 no
5d_25C 7d_30C 0.024170 yes
5d_25C 10d_25C 0.633811 no
7d_25C 7d_15C 0.791119 no
7d_25C 7d_30C 0.003197 yes
7d_25C 10d_25C 0.298433 no
7d_15C 7d_30C 0.001278 yes
7d_15C 10d_25C 0.143169 no
7d_30C 10d_25C 0.095723 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3786.t1
MTSPFLSPYAVGEPDTEPLLITVRFSASIPDLQLDVPEPETTTGAGLKQLIRAQLAKPLSSHRLRLIYAGRGLED
TAALTASLKLPSSPSRSPRPVADQPETPEENGKGKQAVRDTRPRIYIHCSIGDIVLSDADLASEASVSSTILLQQ
KQQKTNTGKKLFGKDVSTSRHSQTQTQTQTQSQSTTTTPAPRGFDRLLSAGFTAAEVTALRSQFLAMQSVSRTPD
TMPTGDQLRDLEDRWMDEGSTAAQVQGGFGEGGGIGDDEGGIGSGSRGAMDDMLWGAVMGFFWPVGCAMWLRREE
GVWSWRKGVAVCVGVIVNAVFGAMRIMN*
Coding >Pro_DTO377G3_2|g3786.t1
ATGACCTCACCCTTCCTCTCTCCATACGCAGTCGGCGAACCAGACACCGAGCCGCTCCTCATCACCGTCCGCTTC
TCCGCCTCAATCCCCGACCTCCAACTAGACGTCCCAGAGCCCGAGACCACAACAGGCGCAGGTCTAAAGCAACTA
ATCCGAGCGCAACTCGCCAAACCCCTGTCATCCCACCGACTACGCCTCATCTACGCCGGCCGCGGTCTCGAAGAC
ACAGCCGCATTAACAGCCTCACTAAAGCTCCCTTCGTCACCAAGCCGGAGCCCTCGCCCCGTAGCAGACCAACCC
GAGACACCAGAAGAAAATGGCAAAGGAAAGCAGGCGGTGCGCGATACCCGCCCACGAATTTACATCCACTGCTCG
ATCGGCGACATCGTACTCTCAGACGCAGACTTAGCTAGCGAAGCAAGCGTGTCATCAACGATCCTTCTGCAACAG
AAGCAACAGAAAACTAACACAGGAAAGAAACTTTTCGGCAAGGATGTCTCGACATCTCGTCACTCCCAGACCCAG
ACCCAGACCCAGACCCAGTCCCAGTCAACTACCACCACACCCGCACCCCGCGGTTTCGACCGCCTCCTCTCGGCC
GGCTTCACGGCGGCTGAGGTCACCGCTCTGCGCTCCCAGTTCCTGGCCATGCAGTCTGTTTCCCGGACGCCGGAT
ACTATGCCTACTGGCGACCAGCTGCGGGATCTTGAGGACCGCTGGATGGATGAGGGGTCGACGGCGGCGCAGGTG
CAGGGTGGGTTTGGGGAGGGGGGTGGTATCGGGGATGACGAGGGCGGGATTGGATCTGGATCGCGTGGGGCGATG
GATGATATGCTTTGGGGCGCTGTTATGGGGTTCTTTTGGCCTGTTGGTTGTGCGATGTGGTTGCGCAGAGAGGAA
GGGGTGTGGAGTTGGAGGAAGGGGGTGGCTGTTTGTGTGGGTGTTATTGTTAATGCTGTTTTTGGGGCGATGAGG
ATTATGAACTGA
Transcript >Pro_DTO377G3_2|g3786.t1
ATGACCTCACCCTTCCTCTCTCCATACGCAGTCGGCGAACCAGACACCGAGCCGCTCCTCATCACCGTCCGCTTC
TCCGCCTCAATCCCCGACCTCCAACTAGACGTCCCAGAGCCCGAGACCACAACAGGCGCAGGTCTAAAGCAACTA
ATCCGAGCGCAACTCGCCAAACCCCTGTCATCCCACCGACTACGCCTCATCTACGCCGGCCGCGGTCTCGAAGAC
ACAGCCGCATTAACAGCCTCACTAAAGCTCCCTTCGTCACCAAGCCGGAGCCCTCGCCCCGTAGCAGACCAACCC
GAGACACCAGAAGAAAATGGCAAAGGAAAGCAGGCGGTGCGCGATACCCGCCCACGAATTTACATCCACTGCTCG
ATCGGCGACATCGTACTCTCAGACGCAGACTTAGCTAGCGAAGCAAGCGTGTCATCAACGATCCTTCTGCAACAG
AAGCAACAGAAAACTAACACAGGAAAGAAACTTTTCGGCAAGGATGTCTCGACATCTCGTCACTCCCAGACCCAG
ACCCAGACCCAGACCCAGTCCCAGTCAACTACCACCACACCCGCACCCCGCGGTTTCGACCGCCTCCTCTCGGCC
GGCTTCACGGCGGCTGAGGTCACCGCTCTGCGCTCCCAGTTCCTGGCCATGCAGTCTGTTTCCCGGACGCCGGAT
ACTATGCCTACTGGCGACCAGCTGCGGGATCTTGAGGACCGCTGGATGGATGAGGGGTCGACGGCGGCGCAGGTG
CAGGGTGGGTTTGGGGAGGGGGGTGGTATCGGGGATGACGAGGGCGGGATTGGATCTGGATCGCGTGGGGCGATG
GATGATATGCTTTGGGGCGCTGTTATGGGGTTCTTTTGGCCTGTTGGTTGTGCGATGTGGTTGCGCAGAGAGGAA
GGGGTGTGGAGTTGGAGGAAGGGGGTGGCTGTTTGTGTGGGTGTTATTGTTAATGCTGTTTTTGGGGCGATGAGG
ATTATGAACTGA
Gene >Pro_DTO377G3_2|g3786.t1
ATGACCTCACCCTTCCTCTCTCCATACGCAGTCGGCGAACCAGACACCGAGCCGCTCCTCATCACCGTCCGCTTC
TCCGCCTCAATCCCCGACCTCCAACTAGACGTCCCAGAGCCCGAGACCACAACAGGCGCAGGTCTAAAGCAACTA
ATCCGAGCGCAACTCGCCAAACCCCTGTCATCCCACCGACTACGCCTCATCTACGCCGGCCGCGGTCTCGAAGAC
ACAGCCGCATTAACAGCCTCACTAAAGCTCCCTTCGTCACCAAGCCGGAGCCCTCGCCCCGTAGCAGACCAACCC
GAGACACCAGAAGAAAATGGCAAAGGAAAGCAGGCGGTGCGCGATACCCGCCCACGAATTTACATCCACTGCTCG
ATCGGCGACATCGTACTCTCAGACGCAGACTTAGCTAGCGAAGCAAGCGTGTCATCAACGATCCTTCTGCAACAG
AAGCAACAGAAAACTAACACAGGAAAGAAACTTTTCGGCAAGGATGTCTCGACATCTCGTCACTCCCAGACCCAG
ACCCAGACCCAGACCCAGTCCCAGTCAACTACCACCACACCCGCACCCCGCGGTTTCGACCGCCTCCTCTCGGCC
GGCTTCACGGCGGCTGAGGTCACCGCTCTGCGCTCCCAGTTCCTGGCCATGCAGTCTGTTTCCCGGACGCCGGAT
ACTATGCCTACTGGCGACCAGCTGCGGGATCTTGAGGACCGCTGGATGGATGAGGGGTCGACGGCGGCGCAGGTG
CAGGGTGGGTTTGGGGAGGGGGGTGGTATCGGGGATGACGAGGGCGGGATTGGATCTGGATCGCGTGGGGCGATG
GATGATATGCTTTGGGGCGCTGTTATGGGGTTCTTTTGGCCTGTTGGTTGTGCGATGTGGTTGCGCAGAGAGGAA
GGGGTGTGGAGTTGGAGGAAGGGGGTGGCTGTTTGTGTGGGTGTTATTGTTAATGCTGTTTTTGGGGCGATGAGG
ATTATGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail