Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3778.t1
Gene name
Locationscaffold_06:732628..744929
Strand-
Gene length (bp)12301
Transcript length (bp)12054
Coding sequence length (bp)12054
Protein length (aa) 4018

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06025 DUF913 Domain of Unknown Function (DUF913) 1.3E-129 546 997
PF06012 DUF908 Domain of Unknown Function (DUF908) 1.2E-112 119 482
PF00632 HECT HECT-domain (ubiquitin-transferase) 1.0E-94 3712 4016
PF14377 UBM Ubiquitin binding region 9.7E-10 2929 2959
PF14377 UBM Ubiquitin binding region 8.7E-08 2965 2998
PF14377 UBM Ubiquitin binding region 1.9E-10 3019 3053

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0019787 ubiquitin-like protein transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3778.t1
MGRIKKVASQKHEATISPFLQEFIAHATSIPVPELPSLLNTFPKLWPFPRGDLYHWINVLDRFDEILASAVDKYL
LNTGPQTQLFARSVLEESYSADESKKPAEGVDAKLNALGYGPEGDRELVEAVLDFSRLLLEKCGNRSLYSSSDRL
GDLLNTTSLSLLQSTLRLSLCLAQRYHSRQRGTHQQSVLQSHYALDLEKLQKIAAPFPRPAIASKTPFGTSSPVL
TKGKEITAKTKVNANELVSLVRDDDGWEEWGDVRVLYYPSGSEQARTTSEFGQTEHGSHVPATPTPLRRSAHPTP
HSNQASNGDESPAVIGGKAEEATRAGKVLELPYSKVSTAKVEDLLAANLPHLPLESKYELLHKLRVAKALTTSRA
TREQILSIKALAVTNLAHVQPESTFQAKVLQSDMEQPKRLQLTYQLAEVVHLGASGDLAVSRSVQTLAIQALDAL
AKHKVRAIDVCAALSVNVNHGILMFLTRKMVNELGPENNDPDDAYYDEWRDALLALLRTLPSSSTRTPETLVAAG
LIPMFVDILNLRTEKSRRVYSRIMEFLDTFVHAVRDALGTLTTAKGFDAMSDLIDHETKTAFEKVNRGDGFPAKY
KNPSVDYQIPYFQQQTLRWMFRFVNHIMQHNGGGFDRVLRNLIDSPQLLTSLRLVFENARVFGSHVWSNAVNILS
SFIHNEPTSYAVIAEAGLSKSLLAAVMGRELHVLEKPPAVEPEDRETEADTEAEPSATQPPSAEAAIQSEGKQKD
REYAIVRPQNTPLAPGIMPAADALACIPGAFGAICLNSSGLDLFQSSDALESFFEIFENPEHIKCLKDDPELVRS
LGTTFDELVRHHPALKTSIMSAVLVMAARINVLGRVKAWELGMGTKMWTQDADGKTTLSGDVFSLFREIGTAVDA
PIDDPASFGAPQLNANTLPNGAKLVVGDLDHVLPSPGPNFEPRDKDDHGLSATDYLFPALRFLGAFFENQTNCTS
FILAGGTEFLLDIATLQSLAFDFHSTNANQEITVLIHMLAETKPHLVVPSLVRRAQAAVDNLSAFWTAPTGSGFF
TELIKPADSKKPALEPTAAAKSGTFFVRHLNAVLLLTDVLREVFASPLYQTRPGQSTSIFGQANLADHYCSLVSS
LSNLLASCVWEGILLEKNIPEKWLKATQASAEKHGSGKSKAAPVTGNPQEPSATPGAEPQREGTSASETAPAQLG
QGPKEDDTEVDEQCPAFKNARTLRYLLSALPTSITGFLHNLGLGIIGKRRTDPLQKQKANAFLVSDAIAEGVLRQ
LQFDPANSSNSPKHRFAYLIVILSHFSHLLYEVSSDRPSPNYLTSVLVSFNKNNGLKVLKDICDVFLSDIKSLPS
AESIPDQDKELADRLASGYGGIKIILGLFADLTAGKFIVDSSQTQALTSHPDRDRDRPDYFQPGQLLVDLRMEIL
PMARDMWNSDFATQSSSPIVRLLIDIMRFSLDGEYEAGAARKADTPPVLVEVPKKPFVVHTERATALLEKGYTDV
DLNKEALYRCNNLLTAAEEYCKAQQWLRAPPRVPPSPGDIKTGLPESASGIDLLDDPGLGEVPPFNAANSLDRSG
ALQLILAQAQRPPFPGGDIDSDMHRNLAEALDNVLNDNDDMDSDDRGESSNQRRPESRNIGASSSESTAPPQGEP
VKRRHMVTIEDLDAERQNIRSNLIDRALDILNEHHDVSFELSDLITSAIKKHNEPVNFRRDIGETLVQSLVSLQM
ENFQTAGKKIAAYAHILALTLQDPDMYLATLEELKDCFSTFLGFIKLPTPEKADQETFPWVGHVLLILEKLLSDD
CQPPQIAWKLPSLDDPNPSGDEPARLEDPLVSLDEKTQLFEALVEILPRVGKDDTLALSMCRVLVILTRERSIAA
RFGEKRNLQRLFVMVKQLSSATNDKLQSAFMLILRHIVEDEATIRQIMRSEIVANFESKTTRQMDTNGYVRHMYH
LVLRAPDIFVEVTNEKLRLLRYDNHQRPQVLGLKADKDRQQKRGRASVFIEEPKPESSSAGEASAPEGTDKGKAQ
TKGAELKAPIVENPDGVIHYLLSELLSYKDVDDKETSLEFSEQAADQSDTQTDVEMAVDEPTPSISSTAAAQTSR
GSKKAEKPQFKADDHPIYIYRCLLLQCLTELLSSYNRTKVEFINFSRKADPLATTPSKPRSGVLNYLLNVLVPLG
TMDHDESLVFKKRSITSTWTMQVLVALCTKTGEFGGVGKRRTDPKYEEDEPELAFVRRFVLEHALRSYKDAMAST
EPLDVKYSKLMSLADLFDKMLSGYSFTNDAGFPTSTRQLAKTMFEKNFIPALTSSVADVDLNFPSSRRVIKYILR
PLNKLTQTAVLLSETSDITIQGDNEDDEISSATSVSDMEDEREETPDLFRHSTLGMLEPRHDEEESSTEESEGED
DEMYDDEYDEEMDYDEDVAEDDGEVVSDEDDDGMGPIEGLSGDAVEVILDEDDDEDEDEDDEDHDHSDMHDDMYD
GEIGGDRDNESLEDGAEDEWESEEMTEDEEEVEMMNQFEDEMADIRQSTRHQGEDQHLGDLFRALNGSGVDDIHG
DALGGDIHEEIDDLDEDVEDEDEMDELDEDMDDFDEDQGSYEDMEDDDLLEPWGWEGDEPPMARGHAQSRFRAAP
PPAWATVTEIMPGRPSGLVPIQPYHRVHRTQIPTHGNDDGTNPLLVRTDRPDPTVPPRVAADAFADWGQSMDPAG
GRVVAMDSPISFMNAIMQAIGGQAAPGFGVVTRPDGIHVHVDRRAVLPGRIQDMLGIPRGAGPPTRTRGDDPHTA
VKFGLGTTRNRWQEEAHIIFNSQYIERTQRVVNSILRLLVPPAIEEEKQRQKLAEEERKRVQAERAEKDRQDRIA
AEEKQRELKQKEEEENARLQAEKEQQEAERQAAGVDEPMEDVQETDTVEDAGPSTQPEAQPAEPARRVYTNIRGR
QVDITGLEIDSEYLEALPEELREEVIMQQLAEHRSQAAAAGEEDTEINQEFLEALPAEIREELLQQEAADRRRRE
RETARRQAAAAGGAGATSSTQPAEEMDAVSFLATLDPSLRQAVLADQPEDVLATLGPDYLNEARGMGGSGRRMAQ
FGDMSAIDHRQPAAGQESKKEQRRQTVQMLDKAGVATLLRLMFMPLQGNARHQLNDILHNVCENRQNRSEVLSVL
LSILQDGSVDSTAIERSFSHLSLRAKAPGAQKTPQSKRSLAIQTASSVSSEVTPIMVIQQCIAALSFLSQFNPHI
AWFFLTEHDSASAGKLKSLRKGKGKDNRANKFALNALLSLLDRKLIMESPNCMEQVSSLLSSITQPLTVLLRREK
ERQEEDKGKKPERPQIEASAELAEAADSSMDTSMTDAPLPTVETSEVPSEETAEGEEATSAEAKKPEDSKEPTGD
GKRKKRTIEPPVVPDHNFRLVVHILAARECNGKIFRDTLSTINNLSAIPGARDVIGNELVAQAQALSDTILGDLE
DLLPHIRQAKTGTDMQGLALAKFSPASSDQAKLLRILTALDYLFDQARADKSKDIEPRSAPKEDVLKKLYESATF
GPLWSKLSDCLTVIRQKENMLNVATILLPLIEALMVVCKNTTLKDQPLSRGSRELSVNSTPADAGLSMENIFFKF
TEEHRKILNELVRQNPRLMSGTFSLLVKNPKVLEFDNKRNYFTRRVHSRGAEPRHPHPPLQLSVRRAEVFLDSFK
SLYFKSADELKYGKLNVRFHGEEGVDAGGVTREWFQVLARGMFNPNYALFIPVAADRTTFHPNRLSGVNSEHLMF
FKFIGRIIGKALYEGRVLDCHFSRAVYKNILGRSVSIKDMETLDLDYYKSLLWMLENDITDIITETFSIETDDFG
EKQVIDLKPGGHDIPVTQENKEEYVQRVVEYRLVESVREQLDNFLKGFHEIIPPELISIFNEQELELLISGLPEI
DVDEWKNNTEYHNYSASSSQIQWFWRAVRSFDKEERAKLLQFVTGTSKVPLNGFKELEGMNGVSKFNIHRDYGHK
DRLPSSHTCFNQLDLPEYESYEDLRQRLYTAVTAGSEYFGFA*
Coding >Pro_DTO377G3_2|g3778.t1
ATGGGGAGAATTAAGAAGGTCGCCAGCCAAAAGCATGAGGCTACAATCTCACCATTTTTGCAAGAATTCATAGCG
CATGCCACAAGTATTCCCGTTCCAGAGCTCCCGTCGCTTCTCAACACATTCCCTAAGCTATGGCCGTTCCCGCGC
GGTGATCTCTACCATTGGATCAATGTCTTGGACCGATTCGACGAGATTCTGGCCTCAGCTGTGGACAAATACCTC
CTGAATACTGGCCCTCAGACCCAACTGTTTGCCCGAAGTGTTTTGGAGGAATCATATTCGGCCGATGAGAGCAAG
AAGCCAGCAGAGGGTGTTGATGCTAAACTAAATGCCCTGGGATACGGCCCTGAAGGAGATAGAGAGCTTGTGGAA
GCAGTTCTTGATTTTTCTCGCCTTTTGCTCGAGAAATGTGGGAACCGAAGCCTGTACAGCAGCAGCGATCGCCTA
GGTGACCTGTTGAACACCACCTCACTTTCTCTCCTACAATCTACATTGCGGCTGTCTCTTTGCTTAGCTCAACGA
TACCACTCTCGCCAGCGTGGCACCCATCAACAGTCCGTATTGCAGTCCCACTATGCGCTTGATCTCGAAAAGTTG
CAGAAAATCGCGGCTCCTTTCCCGCGTCCAGCCATCGCCAGTAAAACACCGTTTGGCACGTCTTCCCCCGTTTTA
ACCAAGGGAAAGGAAATCACAGCCAAGACGAAAGTCAACGCCAATGAACTGGTTTCCCTCGTGCGTGATGACGAT
GGCTGGGAGGAATGGGGAGATGTTCGAGTCCTGTACTATCCCTCAGGCTCTGAACAGGCCAGAACTACGTCCGAA
TTTGGCCAAACAGAGCACGGCTCACACGTTCCAGCTACGCCAACTCCATTGCGACGTAGCGCACACCCCACTCCT
CATTCCAACCAGGCCTCGAATGGAGATGAATCACCAGCTGTTATCGGTGGGAAGGCAGAAGAGGCTACACGAGCG
GGTAAAGTCCTAGAGCTTCCCTATTCAAAAGTTTCAACTGCAAAGGTGGAAGATCTTCTTGCGGCGAACTTGCCT
CATCTGCCCCTTGAATCAAAATATGAGCTGCTTCACAAGCTCCGAGTCGCCAAGGCGTTGACAACGTCGCGTGCT
ACGCGCGAACAGATTCTTTCCATCAAGGCACTGGCAGTGACAAATCTGGCCCATGTTCAGCCGGAGAGTACCTTC
CAAGCAAAGGTCCTTCAATCTGATATGGAACAACCGAAGCGTCTTCAGCTTACTTACCAGCTCGCTGAAGTGGTT
CATCTCGGTGCCAGTGGTGACCTCGCGGTCTCTCGGTCTGTCCAAACTTTGGCGATCCAGGCGTTGGATGCTTTG
GCCAAGCACAAGGTTCGTGCTATCGACGTCTGTGCAGCTTTGAGCGTCAATGTCAACCACGGAATTCTCATGTTC
TTGACCCGTAAAATGGTCAATGAACTAGGCCCCGAAAACAACGACCCGGATGATGCTTACTACGATGAGTGGCGA
GATGCGTTGCTTGCACTCCTACGCACTCTCCCAAGCTCGAGCACACGTACTCCGGAGACCCTGGTTGCAGCAGGT
CTGATTCCCATGTTTGTTGACATCTTGAATCTGCGGACTGAAAAATCCCGCCGAGTCTATTCCCGTATCATGGAG
TTCCTTGACACATTTGTGCACGCGGTCCGTGATGCACTGGGTACATTGACAACAGCGAAGGGTTTTGACGCCATG
TCTGATTTGATTGATCACGAGACCAAGACCGCGTTTGAGAAGGTCAATCGAGGGGATGGATTTCCTGCTAAATAC
AAAAACCCTTCGGTTGACTATCAAATTCCTTACTTTCAGCAGCAGACTCTGCGCTGGATGTTCCGTTTCGTCAAC
CACATCATGCAGCACAATGGCGGAGGCTTCGATCGTGTTCTGCGCAACTTGATCGATTCGCCTCAGCTGTTGACT
TCTCTTCGCCTTGTGTTCGAGAATGCTCGTGTGTTCGGTTCACATGTTTGGAGCAACGCCGTCAACATTCTCAGC
AGCTTCATTCACAACGAGCCTACTAGTTATGCTGTCATCGCCGAGGCTGGCCTCAGCAAGAGCCTTCTTGCTGCG
GTCATGGGTCGTGAACTTCACGTTCTGGAGAAGCCGCCGGCCGTGGAGCCTGAAGACCGGGAGACTGAGGCCGAC
ACCGAGGCCGAACCCTCCGCCACTCAACCGCCCAGCGCCGAAGCCGCTATTCAGTCCGAGGGAAAGCAAAAGGAT
CGCGAGTATGCCATCGTCAGACCCCAGAACACCCCTCTCGCACCTGGCATAATGCCCGCGGCTGATGCTCTTGCT
TGTATCCCTGGCGCATTTGGAGCTATCTGCTTGAACTCCTCCGGTTTGGACCTCTTCCAGTCCTCCGATGCACTA
GAAAGTTTCTTCGAGATCTTCGAGAACCCCGAGCATATCAAGTGCCTTAAGGATGACCCAGAACTGGTTCGTTCG
TTAGGCACGACCTTTGATGAGCTTGTCCGACACCACCCAGCATTGAAAACCTCTATCATGTCTGCCGTTCTTGTA
ATGGCTGCTCGTATCAACGTTCTGGGGCGAGTCAAGGCATGGGAGCTAGGTATGGGCACAAAAATGTGGACCCAA
GATGCCGACGGCAAAACAACTCTTTCAGGAGATGTCTTTTCATTGTTCCGAGAGATCGGCACAGCCGTTGATGCA
CCCATAGACGACCCTGCCTCGTTTGGTGCTCCCCAGCTCAACGCCAACACTCTGCCTAACGGCGCTAAGCTTGTC
GTTGGGGATCTAGATCACGTCCTCCCTTCGCCGGGCCCCAACTTTGAGCCTAGAGATAAGGATGATCATGGTCTT
TCGGCTACGGACTACCTGTTCCCAGCTTTGCGATTCCTGGGCGCTTTCTTCGAGAACCAGACGAACTGCACATCC
TTCATCCTGGCCGGCGGCACAGAGTTCTTGTTAGACATTGCAACACTCCAAAGCTTGGCGTTTGATTTCCACAGC
ACCAACGCCAACCAAGAGATTACCGTGCTTATCCACATGCTAGCGGAAACGAAGCCTCACCTTGTGGTCCCATCT
CTTGTTCGACGCGCACAGGCAGCAGTGGACAATCTTTCAGCCTTTTGGACTGCGCCCACTGGATCGGGATTCTTC
ACAGAATTGATCAAGCCAGCAGATTCAAAAAAACCTGCTCTCGAGCCTACGGCTGCTGCTAAATCTGGCACATTC
TTCGTGAGACATTTGAATGCTGTTCTTCTCCTTACCGATGTCCTTCGCGAGGTTTTCGCATCGCCACTGTACCAA
ACCCGGCCTGGTCAGTCTACCTCTATCTTTGGCCAAGCCAACCTTGCGGACCACTACTGTTCCCTAGTCTCCTCA
TTGAGCAACCTTCTTGCTTCTTGCGTGTGGGAAGGTATTCTACTGGAGAAGAACATCCCCGAGAAGTGGCTGAAA
GCGACACAGGCCTCTGCTGAGAAGCATGGCTCTGGAAAGTCAAAGGCTGCTCCGGTTACTGGGAACCCCCAGGAG
CCTTCAGCAACGCCTGGCGCCGAACCTCAACGTGAGGGCACTAGTGCATCAGAGACTGCTCCAGCTCAGTTGGGC
CAGGGTCCGAAAGAAGATGACACCGAAGTTGATGAACAGTGTCCTGCTTTCAAGAATGCGCGTACGCTTCGCTAC
CTTCTAAGCGCTCTGCCAACCTCGATTACGGGATTCTTGCACAACCTCGGACTCGGGATTATCGGCAAGAGACGC
ACAGATCCGCTGCAGAAACAGAAGGCGAATGCATTTTTGGTCTCAGACGCCATTGCTGAAGGTGTTCTTCGCCAA
CTGCAGTTCGACCCGGCCAATTCCAGCAACAGCCCCAAGCATCGTTTCGCATATCTCATTGTCATCCTTTCACAC
TTCTCGCACCTTCTTTATGAAGTCTCCTCAGATCGTCCCAGTCCGAACTACTTGACTTCAGTTCTCGTCTCGTTC
AATAAAAACAACGGCCTCAAAGTATTGAAAGACATCTGTGACGTCTTCTTGAGTGATATCAAGTCCCTTCCATCT
GCGGAGTCTATTCCCGACCAAGACAAGGAGCTTGCTGACCGGCTTGCATCCGGATATGGTGGAATTAAAATCATT
CTTGGATTATTCGCAGACCTCACTGCTGGGAAATTCATCGTGGACTCTAGCCAGACACAAGCCTTGACTTCTCAC
CCTGACCGGGACCGCGACCGTCCCGACTACTTCCAGCCAGGTCAACTCTTGGTGGATCTTCGCATGGAGATCTTG
CCCATGGCCAGAGACATGTGGAACTCGGACTTTGCGACCCAGTCATCGAGTCCAATTGTCCGATTGTTGATTGAT
ATCATGCGGTTCTCCTTGGATGGTGAATACGAGGCTGGCGCGGCTCGTAAAGCAGATACCCCGCCCGTCTTGGTA
GAGGTGCCCAAGAAACCATTCGTGGTCCACACGGAACGAGCAACTGCCTTGCTTGAGAAAGGGTACACGGATGTT
GATCTCAATAAAGAAGCCCTTTATCGTTGCAACAATCTTTTAACGGCGGCTGAAGAATACTGCAAGGCCCAGCAG
TGGCTACGAGCCCCTCCCAGAGTACCCCCGAGTCCCGGCGATATCAAAACCGGACTACCCGAGTCTGCTTCTGGC
ATCGACCTCCTCGATGACCCTGGTCTTGGAGAGGTTCCACCTTTCAATGCTGCCAATTCGTTAGACCGCTCTGGA
GCCCTCCAGTTGATTCTAGCTCAGGCGCAACGTCCTCCTTTCCCCGGAGGCGATATTGACTCCGACATGCACCGC
AATTTGGCCGAAGCTCTAGACAATGTTCTCAACGACAATGATGACATGGATAGCGATGACCGAGGCGAGTCATCG
AACCAGCGTCGGCCCGAGAGTCGTAATATCGGGGCAAGCTCTTCCGAATCTACCGCGCCCCCTCAGGGAGAACCG
GTGAAACGTCGCCATATGGTCACAATCGAAGATCTGGATGCAGAGAGGCAAAACATTCGGTCAAACCTGATCGAT
CGGGCTCTGGATATTCTAAATGAACATCATGATGTCTCTTTCGAGCTGTCTGACTTGATCACCTCGGCTATCAAG
AAGCACAACGAGCCTGTCAACTTCCGTCGAGACATTGGAGAGACCCTCGTTCAATCGCTAGTCTCTCTACAAATG
GAGAACTTCCAGACAGCTGGCAAAAAGATTGCAGCTTATGCCCACATTCTCGCACTGACCCTTCAAGATCCTGAC
ATGTACCTCGCCACTCTTGAAGAGCTCAAAGATTGCTTCTCGACTTTCCTTGGATTTATCAAGCTCCCAACACCC
GAAAAGGCCGACCAAGAAACCTTCCCTTGGGTTGGACACGTCCTTCTCATTCTCGAGAAGCTTCTGTCTGATGAT
TGCCAGCCTCCCCAGATTGCCTGGAAACTGCCAAGTCTTGATGATCCCAACCCCAGCGGCGATGAACCAGCCCGT
CTTGAAGATCCACTTGTCTCCCTCGATGAGAAGACCCAGCTATTTGAAGCTCTTGTCGAGATCCTACCCCGAGTG
GGCAAGGATGATACACTCGCGCTCTCCATGTGCCGTGTTCTTGTCATTCTCACCCGCGAGCGCAGCATTGCCGCT
CGCTTTGGTGAGAAGCGAAACCTTCAGCGTTTGTTCGTGATGGTTAAACAACTTTCTAGCGCTACAAACGATAAA
CTCCAAAGTGCCTTCATGCTGATTCTTCGTCACATCGTCGAAGACGAAGCTACTATCCGGCAGATCATGAGGAGC
GAAATTGTGGCCAACTTTGAGTCCAAGACTACCCGTCAGATGGACACGAACGGCTATGTACGACATATGTATCAC
CTCGTGCTGAGAGCTCCTGATATCTTTGTGGAGGTTACAAATGAAAAGCTACGGTTGCTCCGATATGACAACCAT
CAACGTCCACAGGTTCTTGGATTGAAGGCCGACAAGGATCGGCAGCAAAAGCGAGGAAGAGCCAGTGTCTTTATT
GAAGAGCCGAAGCCAGAATCATCTTCAGCGGGTGAAGCATCTGCCCCTGAAGGCACGGACAAGGGCAAGGCCCAA
ACCAAGGGTGCCGAACTCAAGGCCCCAATTGTGGAGAACCCGGATGGTGTTATTCATTACCTGCTTTCGGAGCTT
CTGTCCTACAAGGATGTGGACGACAAAGAAACCAGTCTTGAATTCTCGGAGCAGGCAGCTGACCAATCCGATACT
CAAACTGATGTTGAGATGGCTGTGGACGAGCCAACACCTTCGATTTCGAGCACTGCCGCAGCACAAACATCTCGC
GGTTCCAAGAAGGCAGAAAAGCCCCAATTCAAGGCAGATGACCATCCGATTTACATCTACCGCTGCTTGCTCCTT
CAGTGCTTGACGGAACTTCTTTCCTCTTACAACCGGACTAAAGTCGAGTTCATCAACTTTTCCCGCAAGGCTGAT
CCTCTAGCCACTACACCCTCCAAACCGCGCTCTGGCGTCCTCAACTATTTGCTGAACGTGCTTGTTCCCCTTGGT
ACCATGGATCATGATGAGTCTTTGGTGTTCAAAAAGCGCAGTATCACCTCCACATGGACCATGCAAGTGCTTGTT
GCGCTTTGCACCAAGACCGGTGAATTTGGTGGTGTTGGTAAACGTCGTACCGACCCTAAGTATGAGGAGGATGAG
CCTGAGCTTGCTTTTGTCCGCCGCTTTGTGCTAGAGCATGCTCTCCGGTCCTACAAGGATGCTATGGCCTCTACT
GAACCCCTAGATGTCAAGTATTCCAAGCTCATGTCTCTTGCTGACCTCTTCGATAAAATGCTCAGCGGCTACTCC
TTCACCAACGATGCGGGCTTCCCAACTTCAACCAGGCAGCTCGCGAAGACCATGTTCGAAAAGAATTTTATCCCC
GCGCTCACTTCTTCCGTCGCCGATGTCGACTTGAATTTCCCGTCCTCTAGACGTGTCATTAAGTATATTCTTCGT
CCGTTGAATAAACTTACCCAGACTGCCGTACTTCTCAGCGAGACCTCGGACATCACTATCCAAGGTGATAACGAG
GATGATGAGATCTCATCGGCAACTTCCGTTTCTGACATGGAAGATGAACGCGAAGAAACACCTGACCTCTTCCGC
CACTCCACTCTCGGCATGCTAGAGCCTCGTCATGACGAGGAAGAGAGCAGCACCGAAGAATCGGAGGGTGAGGAC
GATGAGATGTACGATGATGAATATGACGAAGAAATGGACTACGACGAGGATGTCGCTGAAGATGATGGTGAAGTC
GTTAGCGACGAAGACGACGATGGCATGGGTCCAATTGAAGGTCTTTCCGGAGATGCAGTCGAAGTCATCCTTGAC
GAAGATGATGACGAGGACGAGGACGAAGATGATGAAGACCACGACCATTCGGACATGCATGATGACATGTATGAT
GGAGAAATCGGTGGTGACAGAGACAACGAAAGCCTCGAAGATGGCGCAGAGGACGAATGGGAAAGTGAAGAAATG
ACCGAAGACGAAGAAGAGGTCGAGATGATGAACCAGTTTGAAGATGAAATGGCCGACATCAGACAATCCACTAGA
CACCAAGGTGAAGATCAACATCTTGGTGACCTATTCCGTGCCCTCAATGGTTCCGGTGTTGATGATATCCATGGA
GATGCTCTAGGTGGTGATATTCACGAAGAAATCGATGACCTCGATGAAGATGTTGAAGACGAAGACGAAATGGAT
GAACTTGACGAGGACATGGATGATTTCGATGAGGACCAAGGATCTTATGAGGATATGGAAGACGATGATCTTCTT
GAGCCGTGGGGATGGGAAGGCGATGAACCTCCAATGGCCCGAGGACATGCGCAATCCCGCTTCCGCGCAGCCCCA
CCACCGGCCTGGGCTACCGTCACTGAAATCATGCCGGGTCGCCCATCCGGTCTCGTTCCCATTCAGCCTTACCAC
CGTGTCCACCGAACCCAAATCCCGACTCACGGCAACGACGATGGCACTAATCCTCTTCTCGTCCGGACTGACCGC
CCAGATCCTACTGTTCCACCTCGGGTTGCTGCTGATGCTTTCGCCGATTGGGGCCAGTCTATGGACCCTGCAGGT
GGCCGGGTTGTTGCCATGGATAGCCCCATCAGCTTCATGAATGCCATTATGCAAGCCATTGGCGGGCAGGCAGCG
CCAGGTTTCGGCGTTGTCACTCGCCCTGATGGTATTCACGTCCATGTCGACCGACGGGCGGTCTTGCCTGGTCGT
ATCCAGGATATGCTCGGGATTCCCCGAGGAGCAGGCCCTCCAACTCGCACTCGCGGCGACGACCCTCACACTGCC
GTCAAGTTTGGTCTTGGTACCACCAGAAACCGCTGGCAAGAAGAGGCCCACATTATCTTCAACAGCCAGTATATT
GAGCGGACCCAGCGCGTCGTCAACTCCATTCTGAGGCTCTTGGTTCCCCCTGCCATCGAGGAGGAGAAGCAGCGC
CAGAAGCTCGCGGAAGAGGAACGCAAGCGTGTTCAAGCCGAAAGGGCTGAAAAGGACCGCCAAGATCGCATTGCC
GCTGAAGAAAAACAGCGCGAGCTTAAGCAAAAGGAGGAGGAGGAGAACGCCCGGCTACAGGCAGAGAAAGAACAA
CAGGAAGCCGAGCGCCAAGCTGCAGGGGTTGATGAGCCCATGGAAGACGTCCAAGAAACCGATACGGTTGAAGAC
GCTGGCCCATCTACTCAACCCGAAGCCCAACCCGCTGAACCCGCTCGTCGAGTCTACACGAACATCAGGGGCCGC
CAAGTTGATATCACCGGTCTCGAGATCGATTCAGAATATCTAGAGGCTCTTCCTGAGGAACTTCGGGAGGAGGTC
ATCATGCAACAGCTTGCTGAACATCGGTCCCAGGCTGCTGCTGCGGGTGAGGAGGATACTGAGATAAACCAAGAA
TTCCTTGAGGCCTTGCCTGCCGAAATCCGCGAAGAATTGCTGCAACAAGAAGCGGCCGATCGACGCCGACGGGAA
CGTGAGACCGCACGACGACAGGCGGCCGCTGCTGGTGGTGCTGGTGCTACTTCTAGCACTCAACCGGCGGAAGAA
ATGGATGCTGTTAGCTTCCTTGCCACTCTCGATCCCTCTTTGCGCCAGGCTGTTCTGGCCGATCAGCCCGAGGAT
GTTCTCGCAACCTTGGGCCCGGATTACTTGAATGAAGCTCGTGGTATGGGCGGTAGCGGCCGACGCATGGCCCAG
TTTGGTGACATGAGTGCCATTGATCACCGCCAGCCTGCTGCAGGCCAAGAGTCGAAGAAAGAGCAGAGACGTCAA
ACTGTTCAAATGCTCGACAAGGCTGGCGTTGCAACCCTTCTCCGTCTAATGTTTATGCCTCTTCAGGGCAACGCT
CGCCATCAATTGAATGATATTCTTCACAATGTTTGCGAGAACCGCCAGAACCGGAGTGAAGTGCTCAGCGTTCTT
CTTTCGATCTTGCAGGATGGCAGCGTCGATTCCACTGCGATCGAACGCAGCTTTTCTCATCTTTCTCTGCGTGCA
AAGGCACCAGGAGCACAAAAGACGCCTCAGTCTAAGCGATCCCTCGCTATCCAGACTGCCTCGAGCGTCAGCAGC
GAAGTGACCCCGATTATGGTCATCCAACAATGTATCGCCGCGCTGTCTTTCCTTTCGCAGTTCAACCCACACATT
GCTTGGTTCTTCCTAACGGAACATGACTCTGCCTCAGCTGGTAAACTCAAGTCATTGCGTAAGGGCAAAGGCAAA
GATAACCGAGCTAACAAGTTCGCTCTGAATGCCCTGCTTTCTCTTCTTGACCGCAAGTTGATAATGGAAAGCCCT
AATTGCATGGAGCAGGTGTCTAGCCTCCTGAGCAGTATCACACAGCCATTGACTGTTCTCCTTCGTCGTGAGAAG
GAGCGACAGGAAGAGGACAAGGGCAAGAAGCCTGAGCGACCTCAAATCGAAGCATCTGCCGAACTTGCTGAGGCT
GCCGACTCCAGTATGGACACATCCATGACGGATGCTCCGCTTCCCACTGTGGAAACTTCCGAAGTCCCTAGTGAA
GAGACCGCAGAGGGTGAAGAGGCTACTTCAGCTGAAGCCAAGAAACCTGAAGATTCCAAGGAGCCCACCGGGGAC
GGGAAGCGCAAGAAGCGAACCATCGAGCCTCCTGTCGTTCCGGATCACAACTTCCGATTAGTTGTCCACATCCTT
GCGGCTCGTGAGTGCAATGGCAAGATATTCCGCGATACACTTTCCACCATCAACAATCTTTCCGCTATTCCCGGA
GCTAGAGATGTGATCGGCAATGAATTGGTTGCTCAAGCGCAGGCCCTCAGCGATACCATCCTGGGTGATTTGGAG
GATCTTCTCCCTCATATCCGCCAGGCCAAGACTGGTACCGACATGCAAGGCCTTGCTCTGGCCAAGTTCTCCCCG
GCTAGCTCAGACCAGGCGAAATTGTTACGTATCCTGACCGCACTTGATTATCTGTTTGACCAAGCACGAGCGGAC
AAGTCCAAGGATATCGAGCCTAGATCCGCTCCGAAGGAAGATGTGCTCAAGAAACTCTATGAAAGCGCCACTTTC
GGCCCGCTTTGGAGCAAACTGAGCGACTGCTTGACTGTCATTCGGCAGAAAGAGAATATGCTGAACGTGGCTACT
ATTCTCCTCCCTCTCATTGAGGCATTGATGGTCGTTTGCAAGAACACCACGCTGAAGGACCAGCCGCTATCTCGC
GGCAGCCGCGAATTGTCAGTCAACAGCACCCCAGCCGATGCTGGTCTCAGCATGGAAAACATATTCTTCAAGTTC
ACAGAAGAACATCGCAAGATTCTCAATGAGCTCGTCCGCCAGAACCCCCGCCTGATGAGCGGCACATTCTCTCTA
TTGGTCAAGAACCCCAAGGTCTTGGAATTCGATAACAAGCGCAACTACTTCACTCGTCGTGTCCACTCCCGCGGT
GCCGAGCCTCGCCACCCTCATCCTCCTCTTCAGCTCTCTGTGCGCAGAGCTGAGGTTTTCCTTGACTCTTTCAAG
TCATTGTACTTCAAGAGCGCGGATGAGTTGAAGTATGGCAAATTGAATGTACGATTCCATGGCGAGGAGGGTGTC
GATGCTGGTGGTGTCACCAGAGAATGGTTCCAGGTTCTTGCGCGTGGCATGTTCAACCCCAACTACGCTTTGTTC
ATCCCTGTCGCCGCTGATCGGACCACATTCCACCCCAATCGCCTCAGTGGGGTCAACTCGGAGCATCTGATGTTC
TTCAAGTTCATCGGGCGCATCATCGGTAAGGCCTTGTACGAAGGTCGTGTTCTCGACTGTCACTTCAGTAGAGCA
GTCTACAAGAATATCCTCGGACGATCCGTGTCTATCAAGGATATGGAAACGCTCGACTTGGACTACTACAAATCA
CTTCTGTGGATGCTGGAGAACGACATTACCGATATCATCACCGAAACCTTTTCCATTGAAACCGATGACTTTGGC
GAGAAGCAGGTCATCGACCTGAAGCCCGGTGGTCACGACATTCCCGTTACACAGGAGAACAAGGAAGAGTACGTT
CAGCGCGTGGTCGAATATCGCCTCGTCGAGTCGGTTCGTGAACAACTGGACAACTTCCTCAAGGGTTTCCACGAA
ATCATTCCTCCCGAGTTGATCTCCATTTTCAACGAGCAAGAGCTGGAACTTTTGATTTCTGGTCTTCCTGAGATT
GATGTGGACGAGTGGAAGAACAACACCGAGTATCACAACTACTCCGCGTCCTCTTCGCAAATCCAGTGGTTCTGG
CGTGCCGTCCGCTCGTTCGACAAGGAGGAGCGTGCCAAGCTGTTGCAGTTCGTCACTGGAACCAGTAAGGTTCCT
CTCAATGGCTTCAAGGAACTTGAGGGTATGAACGGTGTGAGCAAGTTCAACATCCATCGCGACTATGGCCATAAG
GATCGCCTTCCCAGCTCGCATACCTGCTTCAACCAGCTTGATCTTCCTGAGTATGAAAGTTACGAAGATCTCCGT
CAACGCCTTTACACGGCCGTCACGGCTGGAAGTGAGTACTTCGGATTTGCCTAG
Transcript >Pro_DTO377G3_2|g3778.t1
ATGGGGAGAATTAAGAAGGTCGCCAGCCAAAAGCATGAGGCTACAATCTCACCATTTTTGCAAGAATTCATAGCG
CATGCCACAAGTATTCCCGTTCCAGAGCTCCCGTCGCTTCTCAACACATTCCCTAAGCTATGGCCGTTCCCGCGC
GGTGATCTCTACCATTGGATCAATGTCTTGGACCGATTCGACGAGATTCTGGCCTCAGCTGTGGACAAATACCTC
CTGAATACTGGCCCTCAGACCCAACTGTTTGCCCGAAGTGTTTTGGAGGAATCATATTCGGCCGATGAGAGCAAG
AAGCCAGCAGAGGGTGTTGATGCTAAACTAAATGCCCTGGGATACGGCCCTGAAGGAGATAGAGAGCTTGTGGAA
GCAGTTCTTGATTTTTCTCGCCTTTTGCTCGAGAAATGTGGGAACCGAAGCCTGTACAGCAGCAGCGATCGCCTA
GGTGACCTGTTGAACACCACCTCACTTTCTCTCCTACAATCTACATTGCGGCTGTCTCTTTGCTTAGCTCAACGA
TACCACTCTCGCCAGCGTGGCACCCATCAACAGTCCGTATTGCAGTCCCACTATGCGCTTGATCTCGAAAAGTTG
CAGAAAATCGCGGCTCCTTTCCCGCGTCCAGCCATCGCCAGTAAAACACCGTTTGGCACGTCTTCCCCCGTTTTA
ACCAAGGGAAAGGAAATCACAGCCAAGACGAAAGTCAACGCCAATGAACTGGTTTCCCTCGTGCGTGATGACGAT
GGCTGGGAGGAATGGGGAGATGTTCGAGTCCTGTACTATCCCTCAGGCTCTGAACAGGCCAGAACTACGTCCGAA
TTTGGCCAAACAGAGCACGGCTCACACGTTCCAGCTACGCCAACTCCATTGCGACGTAGCGCACACCCCACTCCT
CATTCCAACCAGGCCTCGAATGGAGATGAATCACCAGCTGTTATCGGTGGGAAGGCAGAAGAGGCTACACGAGCG
GGTAAAGTCCTAGAGCTTCCCTATTCAAAAGTTTCAACTGCAAAGGTGGAAGATCTTCTTGCGGCGAACTTGCCT
CATCTGCCCCTTGAATCAAAATATGAGCTGCTTCACAAGCTCCGAGTCGCCAAGGCGTTGACAACGTCGCGTGCT
ACGCGCGAACAGATTCTTTCCATCAAGGCACTGGCAGTGACAAATCTGGCCCATGTTCAGCCGGAGAGTACCTTC
CAAGCAAAGGTCCTTCAATCTGATATGGAACAACCGAAGCGTCTTCAGCTTACTTACCAGCTCGCTGAAGTGGTT
CATCTCGGTGCCAGTGGTGACCTCGCGGTCTCTCGGTCTGTCCAAACTTTGGCGATCCAGGCGTTGGATGCTTTG
GCCAAGCACAAGGTTCGTGCTATCGACGTCTGTGCAGCTTTGAGCGTCAATGTCAACCACGGAATTCTCATGTTC
TTGACCCGTAAAATGGTCAATGAACTAGGCCCCGAAAACAACGACCCGGATGATGCTTACTACGATGAGTGGCGA
GATGCGTTGCTTGCACTCCTACGCACTCTCCCAAGCTCGAGCACACGTACTCCGGAGACCCTGGTTGCAGCAGGT
CTGATTCCCATGTTTGTTGACATCTTGAATCTGCGGACTGAAAAATCCCGCCGAGTCTATTCCCGTATCATGGAG
TTCCTTGACACATTTGTGCACGCGGTCCGTGATGCACTGGGTACATTGACAACAGCGAAGGGTTTTGACGCCATG
TCTGATTTGATTGATCACGAGACCAAGACCGCGTTTGAGAAGGTCAATCGAGGGGATGGATTTCCTGCTAAATAC
AAAAACCCTTCGGTTGACTATCAAATTCCTTACTTTCAGCAGCAGACTCTGCGCTGGATGTTCCGTTTCGTCAAC
CACATCATGCAGCACAATGGCGGAGGCTTCGATCGTGTTCTGCGCAACTTGATCGATTCGCCTCAGCTGTTGACT
TCTCTTCGCCTTGTGTTCGAGAATGCTCGTGTGTTCGGTTCACATGTTTGGAGCAACGCCGTCAACATTCTCAGC
AGCTTCATTCACAACGAGCCTACTAGTTATGCTGTCATCGCCGAGGCTGGCCTCAGCAAGAGCCTTCTTGCTGCG
GTCATGGGTCGTGAACTTCACGTTCTGGAGAAGCCGCCGGCCGTGGAGCCTGAAGACCGGGAGACTGAGGCCGAC
ACCGAGGCCGAACCCTCCGCCACTCAACCGCCCAGCGCCGAAGCCGCTATTCAGTCCGAGGGAAAGCAAAAGGAT
CGCGAGTATGCCATCGTCAGACCCCAGAACACCCCTCTCGCACCTGGCATAATGCCCGCGGCTGATGCTCTTGCT
TGTATCCCTGGCGCATTTGGAGCTATCTGCTTGAACTCCTCCGGTTTGGACCTCTTCCAGTCCTCCGATGCACTA
GAAAGTTTCTTCGAGATCTTCGAGAACCCCGAGCATATCAAGTGCCTTAAGGATGACCCAGAACTGGTTCGTTCG
TTAGGCACGACCTTTGATGAGCTTGTCCGACACCACCCAGCATTGAAAACCTCTATCATGTCTGCCGTTCTTGTA
ATGGCTGCTCGTATCAACGTTCTGGGGCGAGTCAAGGCATGGGAGCTAGGTATGGGCACAAAAATGTGGACCCAA
GATGCCGACGGCAAAACAACTCTTTCAGGAGATGTCTTTTCATTGTTCCGAGAGATCGGCACAGCCGTTGATGCA
CCCATAGACGACCCTGCCTCGTTTGGTGCTCCCCAGCTCAACGCCAACACTCTGCCTAACGGCGCTAAGCTTGTC
GTTGGGGATCTAGATCACGTCCTCCCTTCGCCGGGCCCCAACTTTGAGCCTAGAGATAAGGATGATCATGGTCTT
TCGGCTACGGACTACCTGTTCCCAGCTTTGCGATTCCTGGGCGCTTTCTTCGAGAACCAGACGAACTGCACATCC
TTCATCCTGGCCGGCGGCACAGAGTTCTTGTTAGACATTGCAACACTCCAAAGCTTGGCGTTTGATTTCCACAGC
ACCAACGCCAACCAAGAGATTACCGTGCTTATCCACATGCTAGCGGAAACGAAGCCTCACCTTGTGGTCCCATCT
CTTGTTCGACGCGCACAGGCAGCAGTGGACAATCTTTCAGCCTTTTGGACTGCGCCCACTGGATCGGGATTCTTC
ACAGAATTGATCAAGCCAGCAGATTCAAAAAAACCTGCTCTCGAGCCTACGGCTGCTGCTAAATCTGGCACATTC
TTCGTGAGACATTTGAATGCTGTTCTTCTCCTTACCGATGTCCTTCGCGAGGTTTTCGCATCGCCACTGTACCAA
ACCCGGCCTGGTCAGTCTACCTCTATCTTTGGCCAAGCCAACCTTGCGGACCACTACTGTTCCCTAGTCTCCTCA
TTGAGCAACCTTCTTGCTTCTTGCGTGTGGGAAGGTATTCTACTGGAGAAGAACATCCCCGAGAAGTGGCTGAAA
GCGACACAGGCCTCTGCTGAGAAGCATGGCTCTGGAAAGTCAAAGGCTGCTCCGGTTACTGGGAACCCCCAGGAG
CCTTCAGCAACGCCTGGCGCCGAACCTCAACGTGAGGGCACTAGTGCATCAGAGACTGCTCCAGCTCAGTTGGGC
CAGGGTCCGAAAGAAGATGACACCGAAGTTGATGAACAGTGTCCTGCTTTCAAGAATGCGCGTACGCTTCGCTAC
CTTCTAAGCGCTCTGCCAACCTCGATTACGGGATTCTTGCACAACCTCGGACTCGGGATTATCGGCAAGAGACGC
ACAGATCCGCTGCAGAAACAGAAGGCGAATGCATTTTTGGTCTCAGACGCCATTGCTGAAGGTGTTCTTCGCCAA
CTGCAGTTCGACCCGGCCAATTCCAGCAACAGCCCCAAGCATCGTTTCGCATATCTCATTGTCATCCTTTCACAC
TTCTCGCACCTTCTTTATGAAGTCTCCTCAGATCGTCCCAGTCCGAACTACTTGACTTCAGTTCTCGTCTCGTTC
AATAAAAACAACGGCCTCAAAGTATTGAAAGACATCTGTGACGTCTTCTTGAGTGATATCAAGTCCCTTCCATCT
GCGGAGTCTATTCCCGACCAAGACAAGGAGCTTGCTGACCGGCTTGCATCCGGATATGGTGGAATTAAAATCATT
CTTGGATTATTCGCAGACCTCACTGCTGGGAAATTCATCGTGGACTCTAGCCAGACACAAGCCTTGACTTCTCAC
CCTGACCGGGACCGCGACCGTCCCGACTACTTCCAGCCAGGTCAACTCTTGGTGGATCTTCGCATGGAGATCTTG
CCCATGGCCAGAGACATGTGGAACTCGGACTTTGCGACCCAGTCATCGAGTCCAATTGTCCGATTGTTGATTGAT
ATCATGCGGTTCTCCTTGGATGGTGAATACGAGGCTGGCGCGGCTCGTAAAGCAGATACCCCGCCCGTCTTGGTA
GAGGTGCCCAAGAAACCATTCGTGGTCCACACGGAACGAGCAACTGCCTTGCTTGAGAAAGGGTACACGGATGTT
GATCTCAATAAAGAAGCCCTTTATCGTTGCAACAATCTTTTAACGGCGGCTGAAGAATACTGCAAGGCCCAGCAG
TGGCTACGAGCCCCTCCCAGAGTACCCCCGAGTCCCGGCGATATCAAAACCGGACTACCCGAGTCTGCTTCTGGC
ATCGACCTCCTCGATGACCCTGGTCTTGGAGAGGTTCCACCTTTCAATGCTGCCAATTCGTTAGACCGCTCTGGA
GCCCTCCAGTTGATTCTAGCTCAGGCGCAACGTCCTCCTTTCCCCGGAGGCGATATTGACTCCGACATGCACCGC
AATTTGGCCGAAGCTCTAGACAATGTTCTCAACGACAATGATGACATGGATAGCGATGACCGAGGCGAGTCATCG
AACCAGCGTCGGCCCGAGAGTCGTAATATCGGGGCAAGCTCTTCCGAATCTACCGCGCCCCCTCAGGGAGAACCG
GTGAAACGTCGCCATATGGTCACAATCGAAGATCTGGATGCAGAGAGGCAAAACATTCGGTCAAACCTGATCGAT
CGGGCTCTGGATATTCTAAATGAACATCATGATGTCTCTTTCGAGCTGTCTGACTTGATCACCTCGGCTATCAAG
AAGCACAACGAGCCTGTCAACTTCCGTCGAGACATTGGAGAGACCCTCGTTCAATCGCTAGTCTCTCTACAAATG
GAGAACTTCCAGACAGCTGGCAAAAAGATTGCAGCTTATGCCCACATTCTCGCACTGACCCTTCAAGATCCTGAC
ATGTACCTCGCCACTCTTGAAGAGCTCAAAGATTGCTTCTCGACTTTCCTTGGATTTATCAAGCTCCCAACACCC
GAAAAGGCCGACCAAGAAACCTTCCCTTGGGTTGGACACGTCCTTCTCATTCTCGAGAAGCTTCTGTCTGATGAT
TGCCAGCCTCCCCAGATTGCCTGGAAACTGCCAAGTCTTGATGATCCCAACCCCAGCGGCGATGAACCAGCCCGT
CTTGAAGATCCACTTGTCTCCCTCGATGAGAAGACCCAGCTATTTGAAGCTCTTGTCGAGATCCTACCCCGAGTG
GGCAAGGATGATACACTCGCGCTCTCCATGTGCCGTGTTCTTGTCATTCTCACCCGCGAGCGCAGCATTGCCGCT
CGCTTTGGTGAGAAGCGAAACCTTCAGCGTTTGTTCGTGATGGTTAAACAACTTTCTAGCGCTACAAACGATAAA
CTCCAAAGTGCCTTCATGCTGATTCTTCGTCACATCGTCGAAGACGAAGCTACTATCCGGCAGATCATGAGGAGC
GAAATTGTGGCCAACTTTGAGTCCAAGACTACCCGTCAGATGGACACGAACGGCTATGTACGACATATGTATCAC
CTCGTGCTGAGAGCTCCTGATATCTTTGTGGAGGTTACAAATGAAAAGCTACGGTTGCTCCGATATGACAACCAT
CAACGTCCACAGGTTCTTGGATTGAAGGCCGACAAGGATCGGCAGCAAAAGCGAGGAAGAGCCAGTGTCTTTATT
GAAGAGCCGAAGCCAGAATCATCTTCAGCGGGTGAAGCATCTGCCCCTGAAGGCACGGACAAGGGCAAGGCCCAA
ACCAAGGGTGCCGAACTCAAGGCCCCAATTGTGGAGAACCCGGATGGTGTTATTCATTACCTGCTTTCGGAGCTT
CTGTCCTACAAGGATGTGGACGACAAAGAAACCAGTCTTGAATTCTCGGAGCAGGCAGCTGACCAATCCGATACT
CAAACTGATGTTGAGATGGCTGTGGACGAGCCAACACCTTCGATTTCGAGCACTGCCGCAGCACAAACATCTCGC
GGTTCCAAGAAGGCAGAAAAGCCCCAATTCAAGGCAGATGACCATCCGATTTACATCTACCGCTGCTTGCTCCTT
CAGTGCTTGACGGAACTTCTTTCCTCTTACAACCGGACTAAAGTCGAGTTCATCAACTTTTCCCGCAAGGCTGAT
CCTCTAGCCACTACACCCTCCAAACCGCGCTCTGGCGTCCTCAACTATTTGCTGAACGTGCTTGTTCCCCTTGGT
ACCATGGATCATGATGAGTCTTTGGTGTTCAAAAAGCGCAGTATCACCTCCACATGGACCATGCAAGTGCTTGTT
GCGCTTTGCACCAAGACCGGTGAATTTGGTGGTGTTGGTAAACGTCGTACCGACCCTAAGTATGAGGAGGATGAG
CCTGAGCTTGCTTTTGTCCGCCGCTTTGTGCTAGAGCATGCTCTCCGGTCCTACAAGGATGCTATGGCCTCTACT
GAACCCCTAGATGTCAAGTATTCCAAGCTCATGTCTCTTGCTGACCTCTTCGATAAAATGCTCAGCGGCTACTCC
TTCACCAACGATGCGGGCTTCCCAACTTCAACCAGGCAGCTCGCGAAGACCATGTTCGAAAAGAATTTTATCCCC
GCGCTCACTTCTTCCGTCGCCGATGTCGACTTGAATTTCCCGTCCTCTAGACGTGTCATTAAGTATATTCTTCGT
CCGTTGAATAAACTTACCCAGACTGCCGTACTTCTCAGCGAGACCTCGGACATCACTATCCAAGGTGATAACGAG
GATGATGAGATCTCATCGGCAACTTCCGTTTCTGACATGGAAGATGAACGCGAAGAAACACCTGACCTCTTCCGC
CACTCCACTCTCGGCATGCTAGAGCCTCGTCATGACGAGGAAGAGAGCAGCACCGAAGAATCGGAGGGTGAGGAC
GATGAGATGTACGATGATGAATATGACGAAGAAATGGACTACGACGAGGATGTCGCTGAAGATGATGGTGAAGTC
GTTAGCGACGAAGACGACGATGGCATGGGTCCAATTGAAGGTCTTTCCGGAGATGCAGTCGAAGTCATCCTTGAC
GAAGATGATGACGAGGACGAGGACGAAGATGATGAAGACCACGACCATTCGGACATGCATGATGACATGTATGAT
GGAGAAATCGGTGGTGACAGAGACAACGAAAGCCTCGAAGATGGCGCAGAGGACGAATGGGAAAGTGAAGAAATG
ACCGAAGACGAAGAAGAGGTCGAGATGATGAACCAGTTTGAAGATGAAATGGCCGACATCAGACAATCCACTAGA
CACCAAGGTGAAGATCAACATCTTGGTGACCTATTCCGTGCCCTCAATGGTTCCGGTGTTGATGATATCCATGGA
GATGCTCTAGGTGGTGATATTCACGAAGAAATCGATGACCTCGATGAAGATGTTGAAGACGAAGACGAAATGGAT
GAACTTGACGAGGACATGGATGATTTCGATGAGGACCAAGGATCTTATGAGGATATGGAAGACGATGATCTTCTT
GAGCCGTGGGGATGGGAAGGCGATGAACCTCCAATGGCCCGAGGACATGCGCAATCCCGCTTCCGCGCAGCCCCA
CCACCGGCCTGGGCTACCGTCACTGAAATCATGCCGGGTCGCCCATCCGGTCTCGTTCCCATTCAGCCTTACCAC
CGTGTCCACCGAACCCAAATCCCGACTCACGGCAACGACGATGGCACTAATCCTCTTCTCGTCCGGACTGACCGC
CCAGATCCTACTGTTCCACCTCGGGTTGCTGCTGATGCTTTCGCCGATTGGGGCCAGTCTATGGACCCTGCAGGT
GGCCGGGTTGTTGCCATGGATAGCCCCATCAGCTTCATGAATGCCATTATGCAAGCCATTGGCGGGCAGGCAGCG
CCAGGTTTCGGCGTTGTCACTCGCCCTGATGGTATTCACGTCCATGTCGACCGACGGGCGGTCTTGCCTGGTCGT
ATCCAGGATATGCTCGGGATTCCCCGAGGAGCAGGCCCTCCAACTCGCACTCGCGGCGACGACCCTCACACTGCC
GTCAAGTTTGGTCTTGGTACCACCAGAAACCGCTGGCAAGAAGAGGCCCACATTATCTTCAACAGCCAGTATATT
GAGCGGACCCAGCGCGTCGTCAACTCCATTCTGAGGCTCTTGGTTCCCCCTGCCATCGAGGAGGAGAAGCAGCGC
CAGAAGCTCGCGGAAGAGGAACGCAAGCGTGTTCAAGCCGAAAGGGCTGAAAAGGACCGCCAAGATCGCATTGCC
GCTGAAGAAAAACAGCGCGAGCTTAAGCAAAAGGAGGAGGAGGAGAACGCCCGGCTACAGGCAGAGAAAGAACAA
CAGGAAGCCGAGCGCCAAGCTGCAGGGGTTGATGAGCCCATGGAAGACGTCCAAGAAACCGATACGGTTGAAGAC
GCTGGCCCATCTACTCAACCCGAAGCCCAACCCGCTGAACCCGCTCGTCGAGTCTACACGAACATCAGGGGCCGC
CAAGTTGATATCACCGGTCTCGAGATCGATTCAGAATATCTAGAGGCTCTTCCTGAGGAACTTCGGGAGGAGGTC
ATCATGCAACAGCTTGCTGAACATCGGTCCCAGGCTGCTGCTGCGGGTGAGGAGGATACTGAGATAAACCAAGAA
TTCCTTGAGGCCTTGCCTGCCGAAATCCGCGAAGAATTGCTGCAACAAGAAGCGGCCGATCGACGCCGACGGGAA
CGTGAGACCGCACGACGACAGGCGGCCGCTGCTGGTGGTGCTGGTGCTACTTCTAGCACTCAACCGGCGGAAGAA
ATGGATGCTGTTAGCTTCCTTGCCACTCTCGATCCCTCTTTGCGCCAGGCTGTTCTGGCCGATCAGCCCGAGGAT
GTTCTCGCAACCTTGGGCCCGGATTACTTGAATGAAGCTCGTGGTATGGGCGGTAGCGGCCGACGCATGGCCCAG
TTTGGTGACATGAGTGCCATTGATCACCGCCAGCCTGCTGCAGGCCAAGAGTCGAAGAAAGAGCAGAGACGTCAA
ACTGTTCAAATGCTCGACAAGGCTGGCGTTGCAACCCTTCTCCGTCTAATGTTTATGCCTCTTCAGGGCAACGCT
CGCCATCAATTGAATGATATTCTTCACAATGTTTGCGAGAACCGCCAGAACCGGAGTGAAGTGCTCAGCGTTCTT
CTTTCGATCTTGCAGGATGGCAGCGTCGATTCCACTGCGATCGAACGCAGCTTTTCTCATCTTTCTCTGCGTGCA
AAGGCACCAGGAGCACAAAAGACGCCTCAGTCTAAGCGATCCCTCGCTATCCAGACTGCCTCGAGCGTCAGCAGC
GAAGTGACCCCGATTATGGTCATCCAACAATGTATCGCCGCGCTGTCTTTCCTTTCGCAGTTCAACCCACACATT
GCTTGGTTCTTCCTAACGGAACATGACTCTGCCTCAGCTGGTAAACTCAAGTCATTGCGTAAGGGCAAAGGCAAA
GATAACCGAGCTAACAAGTTCGCTCTGAATGCCCTGCTTTCTCTTCTTGACCGCAAGTTGATAATGGAAAGCCCT
AATTGCATGGAGCAGGTGTCTAGCCTCCTGAGCAGTATCACACAGCCATTGACTGTTCTCCTTCGTCGTGAGAAG
GAGCGACAGGAAGAGGACAAGGGCAAGAAGCCTGAGCGACCTCAAATCGAAGCATCTGCCGAACTTGCTGAGGCT
GCCGACTCCAGTATGGACACATCCATGACGGATGCTCCGCTTCCCACTGTGGAAACTTCCGAAGTCCCTAGTGAA
GAGACCGCAGAGGGTGAAGAGGCTACTTCAGCTGAAGCCAAGAAACCTGAAGATTCCAAGGAGCCCACCGGGGAC
GGGAAGCGCAAGAAGCGAACCATCGAGCCTCCTGTCGTTCCGGATCACAACTTCCGATTAGTTGTCCACATCCTT
GCGGCTCGTGAGTGCAATGGCAAGATATTCCGCGATACACTTTCCACCATCAACAATCTTTCCGCTATTCCCGGA
GCTAGAGATGTGATCGGCAATGAATTGGTTGCTCAAGCGCAGGCCCTCAGCGATACCATCCTGGGTGATTTGGAG
GATCTTCTCCCTCATATCCGCCAGGCCAAGACTGGTACCGACATGCAAGGCCTTGCTCTGGCCAAGTTCTCCCCG
GCTAGCTCAGACCAGGCGAAATTGTTACGTATCCTGACCGCACTTGATTATCTGTTTGACCAAGCACGAGCGGAC
AAGTCCAAGGATATCGAGCCTAGATCCGCTCCGAAGGAAGATGTGCTCAAGAAACTCTATGAAAGCGCCACTTTC
GGCCCGCTTTGGAGCAAACTGAGCGACTGCTTGACTGTCATTCGGCAGAAAGAGAATATGCTGAACGTGGCTACT
ATTCTCCTCCCTCTCATTGAGGCATTGATGGTCGTTTGCAAGAACACCACGCTGAAGGACCAGCCGCTATCTCGC
GGCAGCCGCGAATTGTCAGTCAACAGCACCCCAGCCGATGCTGGTCTCAGCATGGAAAACATATTCTTCAAGTTC
ACAGAAGAACATCGCAAGATTCTCAATGAGCTCGTCCGCCAGAACCCCCGCCTGATGAGCGGCACATTCTCTCTA
TTGGTCAAGAACCCCAAGGTCTTGGAATTCGATAACAAGCGCAACTACTTCACTCGTCGTGTCCACTCCCGCGGT
GCCGAGCCTCGCCACCCTCATCCTCCTCTTCAGCTCTCTGTGCGCAGAGCTGAGGTTTTCCTTGACTCTTTCAAG
TCATTGTACTTCAAGAGCGCGGATGAGTTGAAGTATGGCAAATTGAATGTACGATTCCATGGCGAGGAGGGTGTC
GATGCTGGTGGTGTCACCAGAGAATGGTTCCAGGTTCTTGCGCGTGGCATGTTCAACCCCAACTACGCTTTGTTC
ATCCCTGTCGCCGCTGATCGGACCACATTCCACCCCAATCGCCTCAGTGGGGTCAACTCGGAGCATCTGATGTTC
TTCAAGTTCATCGGGCGCATCATCGGTAAGGCCTTGTACGAAGGTCGTGTTCTCGACTGTCACTTCAGTAGAGCA
GTCTACAAGAATATCCTCGGACGATCCGTGTCTATCAAGGATATGGAAACGCTCGACTTGGACTACTACAAATCA
CTTCTGTGGATGCTGGAGAACGACATTACCGATATCATCACCGAAACCTTTTCCATTGAAACCGATGACTTTGGC
GAGAAGCAGGTCATCGACCTGAAGCCCGGTGGTCACGACATTCCCGTTACACAGGAGAACAAGGAAGAGTACGTT
CAGCGCGTGGTCGAATATCGCCTCGTCGAGTCGGTTCGTGAACAACTGGACAACTTCCTCAAGGGTTTCCACGAA
ATCATTCCTCCCGAGTTGATCTCCATTTTCAACGAGCAAGAGCTGGAACTTTTGATTTCTGGTCTTCCTGAGATT
GATGTGGACGAGTGGAAGAACAACACCGAGTATCACAACTACTCCGCGTCCTCTTCGCAAATCCAGTGGTTCTGG
CGTGCCGTCCGCTCGTTCGACAAGGAGGAGCGTGCCAAGCTGTTGCAGTTCGTCACTGGAACCAGTAAGGTTCCT
CTCAATGGCTTCAAGGAACTTGAGGGTATGAACGGTGTGAGCAAGTTCAACATCCATCGCGACTATGGCCATAAG
GATCGCCTTCCCAGCTCGCATACCTGCTTCAACCAGCTTGATCTTCCTGAGTATGAAAGTTACGAAGATCTCCGT
CAACGCCTTTACACGGCCGTCACGGCTGGAAGTGAGTACTTCGGATTTGCCTAG
Gene >Pro_DTO377G3_2|g3778.t1
ATGGGGAGAATTAAGAAGGTCGCCAGCCAAAAGCATGAGGCTACAATCGTAAGTTACTCTCCGACAGCCTGATGT
GCAACCCAACTAAAATTTTTTTCCTTCCATCACAGTCACCATTTTTGCAAGAATTCATAGCGCATGCCACAAGTA
TTCCCGTTCCAGAGCTCCCGTCGCTTCTCAACACATTCCCTAAGCTATGGCCGTTCCCGCGCGGTGATCTCTACC
ATTGGATCAATGTCTTGGACCGATTCGACGAGATTCTGGCCTCAGCTGTGGACAAATACCTCCTGAATACTGGCC
CTCAGACCCAACTGTTTGCCCGAAGTGTTTTGGAGGAATCATATTCGGCCGATGAGAGCAAGAAGCCAGCAGAGG
GTGTTGATGCTAAACTAAATGCCCTGGGATACGGCCCTGAAGGAGATAGAGAGCTTGTGGAAGCAGTTCTTGATT
TTTCTCGCCTTTTGCTCGAGAAATGTGGGAACCGAAGCCTGTACAGCAGCAGCGATCGCCTAGGTGACCTGTTGA
ACACCACCTCACTTTCTCTCCTACAATCTACATTGCGGCTGTCTCTTTGCTTAGCTCAACGATACCACTCTCGCC
AGCGTGGCACCCATCAACAGTCCGTATTGCAGTCCCACTATGCGCTTGATCTCGAAAAGTTGCAGAAAATCGCGG
CTCCTTTCCCGCGTCCAGCCATCGCCAGTAAAACACCGTTTGGCACGTCTTCCCCCGTTTTAACCAAGGGAAAGG
AAATCACAGCCAAGACGAAAGTCAACGCCAATGAACTGGTTTCCCTCGTGCGTGATGACGATGGCTGGGAGGAAT
GGGGAGATGTTCGAGTCCTGTACTATCCCTCAGGCTCTGAACAGGCCAGAACTACGTCCGAATTTGGCCAAACAG
AGCACGGCTCACACGTTCCAGCTACGCCAACTCCATTGCGACGTAGCGCACACCCCACTCCTCATTCCAACCAGG
CCTCGAATGGAGATGAATCACCAGCTGTTATCGGTGGGAAGGCAGAAGAGGCTACACGAGCGGGTAAAGTCCTAG
AGCTTCCCTATTCAAAAGTTTCAACTGCAAAGGTGGAAGATCTTCTTGCGGCGAACTTGCCTCATCTGCCCCTTG
AATCAAAATATGAGCTGCTTCACAAGCTCCGAGTCGCCAAGGCGTTGACAACGTCGCGTGCTACGCGCGAACAGA
TTCTTTCCATCAAGGCACTGGCAGTGACAAATCTGGCCCATGTTCAGCCGGAGAGTACCTTCCAAGCAAAGGTCC
TTCAATCTGATATGGAACAACCGAAGCGTCTTCAGCTTACTTACCAGCTCGCTGAAGTGGTTCATCTCGGTGCCA
GTGGTGACCTCGCGGTCTCTCGGTCTGTCCAAACTTTGGCGATCCAGGCGTTGGATGCTTTGGCCAAGCACAAGG
TTCGTGCTATCGACGTCTGTGCAGCTTTGAGCGTCAATGTCAACCACGGAATTCTCATGTTCTTGACCCGTAAAA
TGGTCAATGAACTAGGCCCCGAAAACAACGACCCGGATGATGCTTACTACGATGAGTGGCGAGATGCGTTGCTTG
CACTCCTACGCACTCTCCCAAGCTCGAGCACACGTACTCCGGAGACCCTGGTTGCAGCAGGTCTGATTCCCATGT
TTGTTGACATCTTGAATCTGCGGACTGAAAAATCCCGCCGAGTCTATTCCCGTATCATGGAGTTCCTTGACACAT
TTGTGCACGCGGTCCGTGATGCACTGGGTACATTGACAACAGCGAAGGGTTTTGACGCCATGTCTGATTTGATTG
ATCACGAGACCAAGACCGCGTTTGAGAAGGTCAATCGAGGGGATGGATTTCCTGCTAAATACAAAAACCCTTCGG
TTGACTATCAAATTCCTTACTTTCAGCAGCAGACTCTGCGCTGGATGTTCCGTTTCGTCAACCACATCATGCAGC
ACAATGGCGGAGGCTTCGATCGTGTTCTGCGCAACTTGATCGATTCGCCTCAGCTGTTGACTTCTCTTCGCCTTG
TGTTCGAGAATGCTCGTGTGTTCGGTTCACATGTTTGGAGCAACGCCGTCAACATTCTCAGCAGCTTCATTCACA
ACGAGCCTACTAGTTATGCTGTCATCGCCGAGGCTGGCCTCAGCAAGAGCCTTCTTGCTGCGGTCATGGGTCGTG
AACTTCACGTTCTGGAGAAGCCGCCGGCCGTGGAGCCTGAAGACCGGGAGACTGAGGCCGACACCGAGGCCGAAC
CCTCCGCCACTCAACCGCCCAGCGCCGAAGCCGCTATTCAGTCCGAGGGAAAGCAAAAGGATCGCGAGTATGCCA
TCGTCAGACCCCAGAACACCCCTCTCGCACCTGGCATAATGCCCGCGGCTGATGCTCTTGCTTGTATCCCTGGCG
CATTTGGAGCTATCTGCTTGAACTCCTCCGGTTTGGACCTCTTCCAGTCCTCCGATGCACTAGAAAGTTTCTTCG
AGATCTTCGAGAACCCCGAGCATATCAAGTGCCTTAAGGATGACCCAGAACTGGTTCGTTCGTTAGGCACGACCT
TTGATGAGCTTGTCCGACACCACCCAGCATTGAAAACCTCTATCATGTCTGCCGTTCTTGTAATGGCTGCTCGTA
TCAACGTTCTGGGGCGAGTCAAGGCATGGGAGCTAGGTATGGGCACAAAAATGTGGACCCAAGATGCCGACGGCA
AAACAACTCTTTCAGGAGATGTCTTTTCATTGTTCCGAGAGATCGGCACAGCCGTTGATGCACCCATAGACGACC
CTGCCTCGTTTGGTGCTCCCCAGCTCAACGCCAACACTCTGCCTAACGGCGCTAAGCTTGTCGTTGGGGATCTAG
ATCACGTCCTCCCTTCGCCGGGCCCCAACTTTGAGCCTAGAGATAAGGATGATCATGGTCTTTCGGCTACGGACT
ACCTGTTCCCAGCTTTGCGATTCCTGGGCGCTTTCTTCGAGAACCAGACGAACTGCACATCCTTCATCCTGGCCG
GCGGCACAGAGTTCTTGTTAGACATTGCAACACTCCAAAGCTTGGCGTTTGATTTCCACAGCACCAACGCCAACC
AAGAGATTACCGTGCTTATCCACATGCTAGCGGAAACGAAGCCTCACCTTGTGGTCCCATCTCTTGTTCGACGCG
CACAGGCAGCAGTGGACAATCTTTCAGCCTTTTGGACTGCGCCCACTGGATCGGGATTCTTCACAGAATTGATCA
AGCCAGCAGATTCAAAAAAACCTGCTCTCGAGCCTACGGCTGCTGCTAAATCTGGCACATTCTTCGTGAGACATT
TGAATGCTGTTCTTCTCCTTACCGATGTCCTTCGCGAGGTTTTCGCATCGCCACTGTACCAAACCCGGCCTGGTC
AGTCTACCTCTATCTTTGGCCAAGCCAACCTTGCGGACCACTACTGTTCCCTAGTCTCCTCATTGAGCAACCTTC
TTGCTTCTTGCGTGTGGGAAGGTATTCTACTGGAGAAGAACATCCCCGAGAAGTGGCTGAAAGCGACACAGGCCT
CTGCTGAGAAGCATGGCTCTGGAAAGTCAAAGGCTGCTCCGGTTACTGGGAACCCCCAGGAGCCTTCAGCAACGC
CTGGCGCCGAACCTCAACGTGAGGGCACTAGTGCATCAGAGACTGCTCCAGCTCAGTTGGGCCAGGGTCCGAAAG
AAGATGACACCGAAGTTGATGAACAGTGTCCTGCTTTCAAGAATGCGCGTACGCTTCGCTACCTTCTAAGCGCTC
TGCCAACCTCGATTACGGGATTCTTGCACAACCTCGGACTCGGGATTATCGGCAAGAGACGCACAGATCCGCTGC
AGAAACAGAAGGCGAATGCATTTTTGGTCTCAGACGCCATTGCTGAAGGTGTTCTTCGCCAACTGCAGTTCGACC
CGGCCAATTCCAGCAACAGCCCCAAGCATCGTTTCGCATATCTCATTGTCATCCTTTCACACTTCTCGCACCTTC
TTTATGAAGTCTCCTCAGATCGTCCCAGTCCGAACTACTTGACTTCAGTTCTCGTCTCGTTCAATAAAAACAACG
GCCTCAAAGTATTGAAAGACATCTGTGACGTCTTCTTGAGTGATATCAAGTCCCTTCCATCTGCGGAGTCTATTC
CCGACCAAGACAAGGAGCTTGCTGACCGGCTTGCATCCGGATATGGTGGAATTAAAATCATTCTTGGATTATTCG
CAGACCTCACTGCTGGGAAATTCATCGTGGACTCTAGCCAGACACAAGCCTTGACTTCTCACCCTGACCGGGACC
GCGACCGTCCCGACTACTTCCAGCCAGGTCAACTCTTGGTGGATCTTCGCATGGAGATCTTGCCCATGGCCAGAG
ACATGTGGAACTCGGACTTTGCGACCCAGTCATCGAGTCCAATTGTCCGATTGTTGATTGATATCATGCGGTTCT
CCTTGGATGGTGAATACGAGGCTGGCGCGGCTCGTAAAGCAGATACCCCGCCCGTCTTGGTAGAGGTGCCCAAGA
AACCATTCGTGGTCCACACGGAACGAGCAACTGCCTTGCTTGAGAAAGGGTACACGGATGTTGATCTCAATAAAG
AAGCCCTTTATCGTTGCAACAATCTTTTAACGGCGGCTGAAGAATACTGCAAGGCCCAGCAGTGGCTACGAGCCC
CTCCCAGAGTACCCCCGAGTCCCGGCGATATCAAAACCGGACTACCCGAGTCTGCTTCTGGCATCGACCTCCTCG
ATGACCCTGGTCTTGGAGAGGTTCCACCTTTCAATGCTGCCAATTCGTTAGACCGCTCTGGAGCCCTCCAGTTGA
TTCTAGCTCAGGCGCAACGTCCTCCTTTCCCCGGAGGCGATATTGACTCCGACATGCACCGCAATTTGGCCGAAG
CTCTAGACAATGTTCTCAACGACAATGATGACATGGATAGCGATGACCGAGGCGAGTCATCGAACCAGCGTCGGC
CCGAGAGTCGTAATATCGGGGCAAGCTCTTCCGAATCTACCGCGCCCCCTCAGGGAGAACCGGTGAAACGTCGCC
ATATGGTCACAATCGAAGATCTGGATGCAGAGAGGCAAAACATTCGGTCAAACCTGATCGATCGGGCTCTGGATA
TTCTAAATGAACATCATGATGTCTCTTTCGAGCTGTCTGACTTGATCACCTCGGCTATCAAGAAGCACAACGAGC
CTGTCAACTTCCGTCGAGACATTGGAGAGACCCTCGTTCAATCGCTAGTCTCTCTACAAATGGAGAACTTCCAGA
CAGCTGGCAAAAAGATTGCAGCTTATGCCCACATTCTCGCACTGACCCTTCAAGATCCTGACATGTACCTCGCCA
CTCTTGAAGAGCTCAAAGATTGCTTCTCGACTTTCCTTGGATTTATCAAGCTCCCAACACCCGAAAAGGCCGACC
AAGAAACCTTCCCTTGGGTTGGACACGTCCTTCTCATTCTCGAGAAGCTTCTGTCTGATGATTGCCAGCCTCCCC
AGATTGCCTGGAAACTGCCAAGTCTTGATGATCCCAACCCCAGCGGCGATGAACCAGCCCGTCTTGAAGATCCAC
TTGTCTCCCTCGATGAGAAGACCCAGCTATTTGAAGCTCTTGTCGAGATCCTACCCCGAGTGGGCAAGGATGATA
CACTCGCGCTCTCCATGTGCCGTGTTCTTGTCATTCTCACCCGCGAGCGCAGCATTGCCGCTCGCTTTGGTGAGA
AGCGAAACCTTCAGCGTTTGTTCGTGATGGTTAAACAACTTTCTAGCGCTACAAACGATAAACTCCAAAGTGCCT
TCATGCTGATTCTTCGTCACATCGTCGAAGACGAAGCTACTATCCGGCAGATCATGAGGAGCGAAATTGTGGCCA
ACTTTGAGTCCAAGACTACCCGTCAGATGGACACGAACGGCTATGTACGACATATGTATCACCTCGTGCTGAGAG
CTCCTGATATCTTTGTGGAGGTTACAAATGAAAAGCTACGGTTGCTCCGATATGACAACCATCAACGTCCACAGG
TTCTTGGATTGAAGGCCGACAAGGATCGGCAGCAAAAGCGAGGAAGAGCCAGTGTCTTTATTGAAGAGCCGAAGC
CAGAATCATCTTCAGCGGGTGAAGCATCTGCCCCTGAAGGCACGGACAAGGGCAAGGCCCAAACCAAGGGTGCCG
AACTCAAGGCCCCAATTGTGGAGAACCCGGATGGTGTTATTCATTACCTGCTTTCGGAGCTTCTGTCCTACAAGG
ATGTGGACGACAAAGAAACCAGTCTTGAATTCTCGGAGCAGGCAGCTGACCAATCCGATACTCAAACTGATGTTG
AGATGGCTGTGGACGAGCCAACACCTTCGATTTCGAGCACTGCCGCAGCACAAACATCTCGCGGTTCCAAGAAGG
CAGAAAAGCCCCAATTCAAGGCAGATGACCATCCGATTTACATCTACCGCTGCTTGCTCCTTCAGTGCTTGACGG
AACTTCTTTCCTCTTACAACCGGACTAAAGTCGAGTTCATCAACTTTTCCCGCAAGGCTGATCCTCTAGCCACTA
CACCCTCCAAACCGCGCTCTGGCGTCCTCAACTATTTGCTGAACGTGCTTGTTCCCCTTGGTACCATGGATCATG
ATGAGTCTTTGGTGTTCAAAAAGCGCAGTATCACCTCCACATGGACCATGCAAGTGCTTGTTGCGCTTTGCACCA
AGACCGGTGAATTTGGTGGTGTTGGTAAACGTCGTACCGACCCTAAGTATGAGGAGGATGAGCCTGAGCTTGCTT
TTGTCCGCCGCTTTGTGCTAGAGCATGCTCTCCGGTCCTACAAGGATGCTATGGCCTCTACTGAACCCCTAGATG
TCAAGTATTCCAAGCTCATGTCTCTTGCTGACCTCTTCGATAAAATGCTCAGCGGCTACTCCTTCACCAACGATG
CGGGCTTCCCAACTTCAACCAGGCAGCTCGCGAAGACCATGTTCGAAAAGAATTTTATCCCCGCGCTCACTTCTT
CCGTCGCCGATGTCGACTTGAATTTCCCGTCCTCTAGACGTGTCATTAAGTATATTCTTCGTCCGTTGAATAAAC
TTACCCAGACTGCCGTACTTCTCAGCGAGACCTCGGACATCACTATCCAAGGTGATAACGAGGATGATGAGATCT
CATCGGCAACTTCCGTTTCTGACATGGAAGATGAACGCGAAGAAACACCTGACCTCTTCCGCCACTCCACTCTCG
GCATGCTAGAGCCTCGTCATGACGAGGAAGAGAGCAGCACCGAAGAATCGGAGGGTGAGGACGATGAGATGTACG
ATGATGAATATGACGAAGAAATGGACTACGACGAGGATGTCGCTGAAGATGATGGTGAAGTCGTTAGCGACGAAG
ACGACGATGGCATGGGTCCAATTGAAGGTCTTTCCGGAGATGCAGTCGAAGTCATCCTTGACGAAGATGATGACG
AGGACGAGGACGAAGATGATGAAGACCACGACCATTCGGACATGCATGATGACATGTATGATGGAGAAATCGGTG
GTGACAGAGACAACGAAAGCCTCGAAGATGGCGCAGAGGACGAATGGGAAAGTGAAGAAATGACCGAAGACGAAG
AAGAGGTCGAGATGATGAACCAGTTTGAAGATGAAATGGCCGACATCAGACAATCCACTAGACACCAAGGTGAAG
ATCAACATCTTGGTGACCTATTCCGTGCCCTCAATGGTTCCGGTGTTGATGATATCCATGGAGATGCTCTAGGTG
GTGATATTCACGAAGAAATCGATGACCTCGATGAAGATGGTTTGTCCCTCCTTAGACTGCTGAGGCAACAAATGC
CGGCGCAACCACCAGCCTTGCTGACATCCGGTCCAGTTGAAGACGAAGACGAAATGGATGAACTTGACGAGGACA
TGGATGATTTCGATGAGGACCAAGGATCTTATGAGGATATGGAAGGTGAGTCCAACTCTCTCGATGATTTTCTCA
CAGCATTGCTGACTCTCCCAGAAGACGATGATCTTCTTGAGCCGTGGGGATGGGAAGGCGATGAACCTCCAATGG
CCCGAGGACATGCGCAATCCCGCTTCCGCGCAGCCCCACCACCGGCCTGGGCTACCGTCACTGAAATCATGCCGG
GTCGCCCATCCGGTCTCGTTCCCATTCAGCCTTACCACCGTGTCCACCGAACCCAAATCCCGACTCACGGCAACG
ACGATGGCACTAATCCTCTTCTCGTCCGGACTGACCGCCCAGATCCTACTGTTCCACCTCGGGTTGCTGCTGATG
CTTTCGCCGATTGGGGCCAGTCTATGGACCCTGCAGGTGGCCGGGTTGTTGCCATGGATAGCCCCATCAGCTTCA
TGAATGCCATTATGCAAGCCATTGGCGGGCAGGCAGCGCCAGGTTTCGGCGTTGTCACTCGCCCTGATGGTATTC
ACGTCCATGTCGACCGACGGGCGGTCTTGCCTGGTCGTATCCAGGATATGCTCGGGATTCCCCGAGGAGCAGGCC
CTCCAACTCGCACTCGCGGCGACGACCCTCACACTGCCGTCAAGTTTGGTCTTGGTACCACCAGAAACCGCTGGC
AAGAAGAGGCCCACATTATCTTCAACAGCCAGTATATTGAGCGGACCCAGCGCGTCGTCAACTCCATTCTGAGGC
TCTTGGTTCCCCCTGCCATCGAGGAGGAGAAGCAGCGCCAGAAGCTCGCGGAAGAGGAACGCAAGCGTGTTCAAG
CCGAAAGGGCTGAAAAGGACCGCCAAGATCGCATTGCCGCTGAAGAAAAACAGCGCGAGCTTAAGCAAAAGGAGG
AGGAGGAGAACGCCCGGCTACAGGCAGAGAAAGAACAACAGGAAGCCGAGCGCCAAGCTGCAGGGGTTGATGAGC
CCATGGAAGACGTCCAAGAAACCGATACGGTTGAAGACGCTGGCCCATCTACTCAACCCGAAGCCCAACCCGCTG
AACCCGCTCGTCGAGTCTACACGAACATCAGGGGCCGCCAAGTTGATATCACCGGTCTCGAGATCGATTCAGAAT
ATCTAGAGGCTCTTCCTGAGGAACTTCGGGAGGAGGTCATCATGCAACAGCTTGCTGAACATCGGTCCCAGGCTG
CTGCTGCGGGTGAGGAGGATACTGAGATAAACCAAGAATTCCTTGAGGCCTTGCCTGCCGAAATCCGCGAAGAAT
TGCTGCAACAAGAAGCGGCCGATCGACGCCGACGGGAACGTGAGACCGCACGACGACAGGCGGCCGCTGCTGGTG
GTGCTGGTGCTACTTCTAGCACTCAACCGGCGGAAGAAATGGATGCTGTTAGCTTCCTTGCCACTCTCGATCCCT
CTTTGCGCCAGGCTGTTCTGGCCGATCAGCCCGAGGATGTTCTCGCAACCTTGGGCCCGGATTACTTGAATGAAG
CTCGTGGTATGGGCGGTAGCGGCCGACGCATGGCCCAGTTTGGTGACATGAGTGCCATTGATCACCGCCAGCCTG
CTGCAGGCCAAGAGTCGAAGAAAGAGCAGAGACGTCAAACTGTTCAAATGCTCGACAAGGCTGGCGTTGCAACCC
TTCTCCGTCTAATGTTTATGCCTCTTCAGGGCAACGCTCGCCATCAATTGAATGATATTCTTCACAATGTTTGCG
AGAACCGCCAGAACCGGAGTGAAGTGCTCAGCGTTCTTCTTTCGATCTTGCAGGATGGCAGCGTCGATTCCACTG
CGATCGAACGCAGCTTTTCTCATCTTTCTCTGCGTGCAAAGGCACCAGGAGCACAAAAGACGCCTCAGTCTAAGC
GATCCCTCGCTATCCAGACTGCCTCGAGCGTCAGCAGCGAAGTGACCCCGATTATGGTCATCCAACAATGTATCG
CCGCGCTGTCTTTCCTTTCGCAGTTCAACCCACACATTGCTTGGTTCTTCCTAACGGAACATGACTCTGCCTCAG
CTGGTAAACTCAAGTCATTGCGTAAGGGCAAAGGCAAAGATAACCGAGCTAACAAGTTCGCTCTGAATGCCCTGC
TTTCTCTTCTTGACCGCAAGTTGATAATGGAAAGCCCTAATTGCATGGAGCAGGTGTCTAGCCTCCTGAGCAGTA
TCACACAGCCATTGACTGTTCTCCTTCGTCGTGAGAAGGAGCGACAGGAAGAGGACAAGGGCAAGAAGCCTGAGC
GACCTCAAATCGAAGCATCTGCCGAACTTGCTGAGGCTGCCGACTCCAGTATGGACACATCCATGACGGATGCTC
CGCTTCCCACTGTGGAAACTTCCGAAGTCCCTAGTGAAGAGACCGCAGAGGGTGAAGAGGCTACTTCAGCTGAAG
CCAAGAAACCTGAAGATTCCAAGGAGCCCACCGGGGACGGGAAGCGCAAGAAGCGAACCATCGAGCCTCCTGTCG
TTCCGGATCACAACTTCCGATTAGTTGTCCACATCCTTGCGGCTCGTGAGTGCAATGGCAAGATATTCCGCGATA
CACTTTCCACCATCAACAATCTTTCCGCTATTCCCGGAGCTAGAGATGTGATCGGCAATGAATTGGTTGCTCAAG
CGCAGGCCCTCAGCGATACCATCCTGGGTGATTTGGAGGATCTTCTCCCTCATATCCGCCAGGCCAAGACTGGTA
CCGACATGCAAGGCCTTGCTCTGGCCAAGTTCTCCCCGGCTAGCTCAGACCAGGCGAAATTGTTACGTATCCTGA
CCGCACTTGATTATCTGTTTGACCAAGCACGAGCGGACAAGTCCAAGGATATCGAGCCTAGATCCGCTCCGAAGG
AAGATGTGCTCAAGAAACTCTATGAAAGCGCCACTTTCGGCCCGCTTTGGAGCAAACTGAGCGACTGCTTGACTG
TCATTCGGCAGAAAGAGAATATGCTGAACGTGGCTACTATTCTCCTCCCTCTCATTGAGGCATTGATGGTCGTTT
GCAAGAACACCACGCTGAAGGACCAGCCGCTATCTCGCGGCAGCCGCGAATTGTCAGTCAACAGCACCCCAGCCG
ATGCTGGTCTCAGCATGGAAAACATATTCTTCAAGTTCACAGAAGAACATCGCAAGATTCTCAATGAGCTCGTCC
GCCAGAACCCCCGCCTGATGAGCGGCACATTCTCTCTATTGGTCAAGAACCCCAAGGTCTTGGAATTCGATAACA
AGCGCAACTACTTCACTCGTCGTGTCCACTCCCGCGGTGCCGAGCCTCGCCACCCTCATCCTCCTCTTCAGCTCT
CTGTGCGCAGAGCTGAGGTTTTCCTTGACTCTTTCAAGTCATTGTACTTCAAGAGCGCGGATGAGTTGAAGTATG
GCAAATTGAATGTACGATTCCATGGCGAGGAGGGTGTCGATGCTGGTGGTGTCACCAGAGAATGGTTCCAGGTTC
TTGCGCGTGGCATGTTCAACCCCAACTACGCTTTGTTCATCCCTGTCGCCGCTGATCGGACCACATTCCACCCCA
ATCGCCTCAGTGGGGTCAACTCGGAGCATCTGATGTTCTTCAAGTTCATCGGGCGCATCATCGGTAAGGCCTTGT
ACGAAGGTCGTGTTCTCGACTGTCACTTCAGTAGAGCAGTCTACAAGAATATCCTCGGACGATCCGTGTCTATCA
AGGATATGGAAACGCTCGACTTGGACTACTACAAATCACTTCTGTGGATGCTGGAGAACGACATTACCGATATCA
TCACCGAAACCTTTTCCATTGAAACCGATGACTTTGGCGAGAAGCAGGTCATCGACCTGAAGCCCGGTGGTCACG
ACATTCCCGTTACACAGGAGAACAAGGAAGAGTACGTTCAGCGCGTGGTCGAATATCGCCTCGTCGAGTCGGTTC
GTGAACAACTGGACAACTTCCTCAAGGGTTTCCACGAAATCATTCCTCCCGAGTTGATCTCCATTTTCAACGAGC
AAGAGCTGGAACTTTTGATTTCTGGTCTTCCTGAGATTGATGTGGACGAGTGGAAGAACAACACCGAGTATCACA
ACTACTCCGCGTCCTCTTCGCAAATCCAGTGGTTCTGGCGTGCCGTCCGCTCGTTCGACAAGGAGGAGCGTGCCA
AGCTGTTGCAGTTCGTCACTGGAACCAGTAAGGTTCCTCTCAATGGCTTCAAGGAACTTGAGGGTATGAACGGTG
TGAGCAAGTTCAACATCCATCGCGACTATGGCCATAAGGATCGCCTTCCCAGCTCGCATACCTGCTTCAACCGTA
AGTTTTTCTCCGCATTTCTTGACTGCATTAGCGCATTTTACTAACTATTTTAACAGAGCTTGATCTTCCTGAGTA
TGAAAGTTACGAAGATCTCCGTCAACGCCTTTACACGGCCGTCACGGCTGGAAGTGAGTACTTCGGATTTGCCTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail