Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3777.t1
Gene name
Locationscaffold_06:730902..732145
Strand-
Gene length (bp)1243
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase 1.1E-44 6 123
PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain 1.3E-33 202 315
PF00156 Pribosyltran Phosphoribosyl transferase domain 4.3E-16 156 252

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0009165 nucleotide biosynthetic process Yes
GO:0000287 magnesium ion binding Yes
GO:0004749 ribose phosphate diphosphokinase activity Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0009987 cellular process No
GO:0019637 organophosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0003824 catalytic activity No
GO:0009117 nucleotide metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0016740 transferase activity No
GO:0006793 phosphorus metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0043167 ion binding No
GO:0016778 diphosphotransferase activity No
GO:0018130 heterocycle biosynthetic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901576 organic substance biosynthetic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3777.t1
MSTNSIKLLTGNSHPELANLVADRLGIELTKIMVLQYSNQETSVTIGESVRDEDVFILQSTKPNDINDGLMELLI
MINACKTASARRITAVIPNFPYARQDKKDKSRAPITAKLMANMLQTAGCNHVITMDLHASQIQGFFNVPVDNLYA
EPSMLKYIRENLDVSNCVIVSPDAGGAKRATAIADRLDLQFALIHKERARPNEVSRMVLVGNVKDKVAIIVDDMA
DTCGTLVKAAETVMQHGATEVNAIVVHGILSGKAIENLNGSCLKRIIVSNTVPLGDKQEQCDKIHTIDISPTLAE
ACRRTHNGESVSFLFSHTVG*
Coding >Pro_DTO377G3_2|g3777.t1
ATGTCGACCAACTCCATTAAGCTCTTGACTGGCAACAGTCACCCGGAGCTTGCCAACCTAGTTGCTGACCGGCTC
GGCATTGAGTTGACCAAGATTATGGTCCTGCAATATTCCAACCAGGAAACCAGTGTCACAATCGGAGAGAGTGTC
CGGGACGAAGATGTCTTCATCCTCCAATCGACAAAACCCAATGATATCAACGATGGACTTATGGAGCTCCTGATC
ATGATCAACGCCTGCAAGACCGCCTCGGCCCGCCGTATCACAGCCGTCATTCCCAACTTCCCTTATGCCCGCCAA
GATAAGAAGGACAAGAGCCGTGCTCCCATCACCGCCAAGCTGATGGCCAACATGCTCCAGACCGCCGGCTGCAAC
CACGTCATCACCATGGACCTGCACGCCAGCCAGATCCAGGGCTTCTTCAACGTCCCCGTCGACAACCTGTACGCC
GAGCCTAGCATGCTCAAGTATATCCGCGAGAACCTCGATGTCAGCAACTGTGTCATCGTCAGCCCGGATGCTGGC
GGTGCCAAGCGTGCTACTGCCATTGCCGATCGCCTGGATCTGCAATTCGCACTTATTCACAAGGAACGTGCCCGC
CCCAATGAGGTCTCGCGCATGGTCCTTGTCGGTAACGTCAAGGATAAGGTCGCTATCATCGTCGATGATATGGCC
GACACCTGCGGGACGCTCGTCAAGGCTGCCGAAACCGTCATGCAGCACGGTGCCACCGAAGTCAACGCCATCGTT
GTCCACGGTATTCTGTCCGGCAAGGCTATTGAGAACCTGAACGGTAGCTGCCTCAAGCGCATTATCGTCAGCAAC
ACTGTCCCATTGGGCGACAAGCAGGAGCAGTGCGACAAGATCCATACGATCGATATCAGCCCGACATTGGCAGAG
GCTTGCCGTCGTACACACAACGGCGAGTCAGTTAGCTTCTTGTTCTCGCACACCGTGGGGTAA
Transcript >Pro_DTO377G3_2|g3777.t1
ATGTCGACCAACTCCATTAAGCTCTTGACTGGCAACAGTCACCCGGAGCTTGCCAACCTAGTTGCTGACCGGCTC
GGCATTGAGTTGACCAAGATTATGGTCCTGCAATATTCCAACCAGGAAACCAGTGTCACAATCGGAGAGAGTGTC
CGGGACGAAGATGTCTTCATCCTCCAATCGACAAAACCCAATGATATCAACGATGGACTTATGGAGCTCCTGATC
ATGATCAACGCCTGCAAGACCGCCTCGGCCCGCCGTATCACAGCCGTCATTCCCAACTTCCCTTATGCCCGCCAA
GATAAGAAGGACAAGAGCCGTGCTCCCATCACCGCCAAGCTGATGGCCAACATGCTCCAGACCGCCGGCTGCAAC
CACGTCATCACCATGGACCTGCACGCCAGCCAGATCCAGGGCTTCTTCAACGTCCCCGTCGACAACCTGTACGCC
GAGCCTAGCATGCTCAAGTATATCCGCGAGAACCTCGATGTCAGCAACTGTGTCATCGTCAGCCCGGATGCTGGC
GGTGCCAAGCGTGCTACTGCCATTGCCGATCGCCTGGATCTGCAATTCGCACTTATTCACAAGGAACGTGCCCGC
CCCAATGAGGTCTCGCGCATGGTCCTTGTCGGTAACGTCAAGGATAAGGTCGCTATCATCGTCGATGATATGGCC
GACACCTGCGGGACGCTCGTCAAGGCTGCCGAAACCGTCATGCAGCACGGTGCCACCGAAGTCAACGCCATCGTT
GTCCACGGTATTCTGTCCGGCAAGGCTATTGAGAACCTGAACGGTAGCTGCCTCAAGCGCATTATCGTCAGCAAC
ACTGTCCCATTGGGCGACAAGCAGGAGCAGTGCGACAAGATCCATACGATCGATATCAGCCCGACATTGGCAGAG
GCTTGCCGTCGTACACACAACGGCGAGTCAGTTAGCTTCTTGTTCTCGCACACCGTGGGGTAA
Gene >Pro_DTO377G3_2|g3777.t1
ATGTCGACCAACTCCATTAAGCTCTTGACTGGCAACAGTCACCCGGAGCTTGCCAACCTAGTTGCTGACCGGTAT
GTGCAACCGGCTAGGGCAAAACTGGGCAACCGGCTAATTCTAGAACTATGAATTAGGCTCGGCATTGAGTTGACC
AAGATTATGGTCCTGCAATATTCCAACCAGGAAACCAGTGTCACAATCGGAGAGAGTGTCCGGGACGAAGATGGT
AAGAACATCCCACCTTAATCGTGATATCAAGAACCCCCGCTCATATATATATGATTTGTTACAGTCTTCATCCTC
CAATCGACAAAACCCAATGATATCAACGATGGACTTATGGAGCTCCTGATCATGATCAACGCCTGCAAGACCGCC
TCGGCCCGCCGTATCACAGCCGTCATTCCCAACTTCCCTTATGCCCGCCAAGATAAGAAGGACAAGAGCCGTGCT
CCCATCACCGCCAAGCTGATGGCCAACATGCTCCAGACCGCCGGCTGCAACCACGTCATCACCATGGACCTGCAC
GCCAGCCAGATCCAGGGCTTCTTCAACGTCCCCGTCGACAACCTGTACGCCGAGCCTAGCATGCTCAAGTATATC
CGCGAGAACCTCGATGTCAGCAACTGTGTCATCGTCAGCCCGGATGCTGGCGGTGCCAAGCGGTAAGCCATGTCT
ATCTCGATACTACACGTATATGTATAGTTCAAGGGCTAATGTGGATTTAAGTGCTACTGCCATTGCCGATCGCCT
GGATCTGCAATTCGCACTTATTCACAAGGAACGTGCCCGCCCCAATGAGGTCTCGCGCATGGTCCTTGTCGGTAA
CGTCAAGGATAAGGTCGCTATCATCGTCGATGATATGGCCGACACCTGCGGGACGCTCGTCAAGGCTGCCGAAAC
CGTCATGCAGCACGGTGCCACCGAAGTCAACGCCATCGTTGTCCACGGTATTCTGTCCGGCAAGGCTATTGAGAA
CCTGAACGGTAGCTGCCTCAAGCGGTATGTGCATGTCCGAATGCCATCGACGAGTCATTGCACTCTTGGATGGTT
TCCGATTTTTCGGTTCACCTTTGGCTAACTTTCTCGTAGCATTATCGTCAGCAACACTGTCCCATTGGGCGACAA
GCAGGAGCAGTGCGACAAGATCCATACGATCGATATCAGCCCGACATTGGCAGAGGCTTGCCGTCGTACACACAA
CGGCGAGTCAGTTAGCTTCTTGTTCTCGCACACCGTGGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail