Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3758.t1
Gene name
Locationscaffold_06:677202..678077
Strand-
Gene length (bp)875
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 44.08 19.86 68.31
5d_25C Five days - 25 degrees Celsius 63.51 31.55 95.46
7d_25C Seven days - 25 degrees Celsius 57.32 27.49 87.14
10d_25C Ten days - 25 degrees Celsius 71.15 35.82 106.49
7d_15C Seven days - 15 degrees Celsius 51.15 23.71 78.60
7d_30C Seven days - 30 degrees Celsius 68.16 34.45 101.86

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.237906 no
3d_25C 7d_25C 0.441553 no
3d_25C 7d_15C 0.713654 no
3d_25C 7d_30C 0.150713 no
3d_25C 10d_25C 0.105926 no
5d_25C 7d_25C 0.792900 no
5d_25C 7d_15C 0.535602 no
5d_25C 7d_30C 0.863917 no
5d_25C 10d_25C 0.763961 no
7d_25C 7d_15C 0.775777 no
7d_25C 7d_30C 0.618550 no
7d_25C 10d_25C 0.509486 no
7d_15C 7d_30C 0.376975 no
7d_15C 10d_25C 0.294003 no
7d_30C 10d_25C 0.920503 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3758.t1
MIRRALTAASSARASPPSTLTSASACKLQLTRPSWHLSPSTTRLFTTTPFTAFTASPPTKDPSPFRLAANKPDSS
PPSFEDVYYSQYQPKRQWPPDMSKLSPKHQFRLERKYRRRAALKYARPKFTKAVLLGQWVVIGFVIIYAVLFMEW
ESDDTAFHAIRKSFFAGLQTVFSSAPPPGPRKDQKDNTASEESS*
Coding >Pro_DTO377G3_2|g3758.t1
ATGATCCGACGCGCCCTAACCGCCGCCTCATCAGCGCGCGCATCACCCCCAAGCACATTGACAAGCGCCTCAGCC
TGCAAGCTCCAACTCACCCGGCCATCATGGCACCTTAGCCCCAGCACCACCCGCCTCTTCACCACCACCCCGTTC
ACAGCCTTCACAGCATCACCACCAACCAAAGACCCCTCACCCTTCCGCCTCGCCGCAAATAAACCCGACTCCTCC
CCGCCCTCGTTCGAAGATGTCTATTACAGCCAGTACCAGCCAAAGCGCCAATGGCCTCCGGATATGTCCAAGCTG
TCTCCGAAACACCAGTTCCGGCTTGAGCGCAAGTACCGGCGGCGCGCGGCGCTCAAGTATGCCCGGCCGAAGTTT
ACGAAGGCTGTTTTGTTGGGACAGTGGGTTGTTATTGGATTTGTCATTATCTATGCGGTGCTATTTATGGAGTGG
GAGTCGGATGATACTGCATTCCATGCGATTCGGAAAAGCTTCTTTGCTGGTCTACAGACTGTATTCTCCAGTGCA
CCACCTCCTGGCCCGAGAAAGGATCAGAAGGATAATACAGCGTCTGAGGAGAGCTCGTAG
Transcript >Pro_DTO377G3_2|g3758.t1
ATGATCCGACGCGCCCTAACCGCCGCCTCATCAGCGCGCGCATCACCCCCAAGCACATTGACAAGCGCCTCAGCC
TGCAAGCTCCAACTCACCCGGCCATCATGGCACCTTAGCCCCAGCACCACCCGCCTCTTCACCACCACCCCGTTC
ACAGCCTTCACAGCATCACCACCAACCAAAGACCCCTCACCCTTCCGCCTCGCCGCAAATAAACCCGACTCCTCC
CCGCCCTCGTTCGAAGATGTCTATTACAGCCAGTACCAGCCAAAGCGCCAATGGCCTCCGGATATGTCCAAGCTG
TCTCCGAAACACCAGTTCCGGCTTGAGCGCAAGTACCGGCGGCGCGCGGCGCTCAAGTATGCCCGGCCGAAGTTT
ACGAAGGCTGTTTTGTTGGGACAGTGGGTTGTTATTGGATTTGTCATTATCTATGCGGTGCTATTTATGGAGTGG
GAGTCGGATGATACTGCATTCCATGCGATTCGGAAAAGCTTCTTTGCTGGTCTACAGACTGTATTCTCCAGTGCA
CCACCTCCTGGCCCGAGAAAGGATCAGAAGGATAATACAGCGTCTGAGGAGAGCTCGTAG
Gene >Pro_DTO377G3_2|g3758.t1
ATGATCCGACGCGCCCTAACCGCCGCCTCATCAGCGCGCGCATCACCCCCAAGCACATTGACAAGCGCCTCAGCC
TGCAAGCTCCAACTCACCCGGCCATCATGGCACCTTGTACGCGACCCGACCCCTCGCCAAGCAGGAGCATATAAT
TAGAATGCCTCTCGAGCATATCTCCAAGCCCAAACCTCAAGCAAAAAACTAACAGGGAACCCGCGCCAACAGAGC
CCCAGCACCACCCGCCTCTTCACCACCACCCCGTTCACAGCCTTCACAGCATCACCACCAACCAAAGACCCCTCA
CCCTTCCGCCTCGCCGCAAATAAACCCGACTCCTCCCCGCCCTCGTTCGAAGATGTCTATTACAGCCAGTACCAG
CCAAAGCGCCAATGGCCTCCGGATATGTCCAAGCTGTCTCCGAAACACCAGTTCCGGCTTGAGCGCAAGTACCGG
CGGCGCGCGGCGCTCAAGTATGCCCGGCCGAAGTTTACGAAGGCTGTTTTGTTGGGACAGTGGGTTGTTATTGGA
TGTGAGTTTTCTCTTGAGATGGGGTTAGGGTTGGAAATTTGTGGATTGCGAATTGCTTATACACTTGCGGTGGAT
AATGGGGTTGGATTTCGAGGAAAGATGCTGACTTTTTATGATACGTAGTTGTCATTATCTATGCGGTGCTATTTA
TGGAGTGGGAGTCGGATGATACTGCATTCCATGCGGTAAGATATCTCTCTGGAAATTATGCTCATTTGTGTCTTG
ACTAACATTATTTCTAGATTCGGAAAAGCTTCTTTGCTGGTCTACAGACTGTATTCTCCAGTGCACCACCTCCTG
GCCCGAGAAAGGATCAGAAGGATAATACAGCGTCTGAGGAGAGCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail