Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3754.t1
Gene name
Locationscaffold_06:659145..660909
Strand-
Gene length (bp)1764
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-11 366 451
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-08 365 479
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 8.2E-09 123 280
PF08242 Methyltransf_12 Methyltransferase domain 3.2E-08 367 450
PF08241 Methyltransf_11 Methyltransferase domain 1.3E-07 367 446
PF13489 Methyltransf_23 Methyltransferase domain 2.0E-06 361 448
PF02655 ATP-grasp_3 ATP-grasp domain 2.3E-06 99 277

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0046872 metal ion binding Yes
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016740 transferase activity No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3754.t1
MKICLINSSYEGVDSPFEKYDDFPDPNRYIPKDRHEFFTRYVTKRNAEAEIDEICKEHFDMFMNYMWGIETDDVA
GVEATRYLETKGVPILTNPSTFLAKNKVDLQRAAEKTGLRVPENTPGKYPKIVKYSDGYGSLSLDEASICYTEKE
VTDRVALLQEKETPFGIIVQDYIIGRECSAIVVEMGKEVVALTPLQYVFPKDTPDNEAFLTWYNKFEAVDKGTIK
YAFVEEQPHIKNLQNAAVDAFKAIGVSGGGGWARVDMRLEERTGLVYVIEVNCIPVVFYPKGNTLGDDLVVGERF
PGGQAAFFDMLLATKQMQLGWHRVQNAHVAEVYNKFAPSYHSVWSNSELSEMQKYLTTNWDYSGTVLDVACGTGG
FGQFLHAQGIQAEVTGIDLSPGMLENVEHYRELRVGPMEEQIMGAGEYDHIVCFGALHFLGPVYLNAVLARMFML
ARKSVSISVDDVSDEYIQAIKEKHGELTFNANHVKAIEEFGIPKGWKRVYHERRLMYSSPTNGEKVYGYGMRFER
ADA*
Coding >Pro_DTO377G3_2|g3754.t1
ATGAAGATTTGTTTGATTAATTCGTCATACGAAGGAGTTGACTCCCCTTTCGAGAAGTATGATGACTTTCCCGAC
CCTAATCGGTATATTCCAAAAGACCGGCATGAGTTTTTCACTCGTTACGTCACCAAGAGAAATGCTGAGGCGGAG
ATTGACGAGATTTGCAAAGAACATTTTGATATGTTCATGAATTACATGTGGGGCATCGAAACCGACGATGTGGCA
GGAGTTGAAGCCACCAGATACCTCGAAACCAAGGGTGTTCCCATCCTCACCAACCCATCGACATTTCTAGCAAAG
AATAAAGTCGATCTCCAGAGGGCCGCTGAGAAAACAGGTCTCCGTGTTCCCGAAAACACCCCAGGGAAATACCCC
AAAATTGTCAAGTACTCTGACGGATATGGTTCGTTGAGTCTGGATGAGGCATCAATCTGCTACACGGAGAAAGAA
GTGACGGATCGCGTGGCCCTTTTGCAGGAGAAAGAAACACCCTTTGGCATCATCGTCCAGGATTATATCATCGGC
CGGGAATGTTCTGCTATAGTTGTGGAAATGGGAAAGGAGGTGGTGGCATTGACACCGCTGCAATATGTCTTTCCG
AAAGACACTCCCGACAACGAAGCCTTCTTGACGTGGTATAACAAATTCGAAGCTGTTGATAAAGGCACCATCAAA
TATGCATTTGTGGAAGAGCAGCCTCACATCAAAAACCTCCAGAATGCGGCTGTGGACGCATTCAAAGCAATTGGT
GTCAGCGGTGGTGGTGGGTGGGCCCGTGTTGATATGCGTCTGGAGGAAAGAACCGGGCTTGTCTACGTGATTGAA
GTCAATTGTATCCCCGTGGTCTTTTACCCAAAGGGAAACACACTTGGTGATGACCTTGTTGTGGGAGAGAGATTT
CCTGGTGGCCAGGCTGCATTTTTTGACATGTTACTAGCGACCAAGCAGATGCAGCTTGGGTGGCACCGTGTTCAA
AATGCTCATGTCGCCGAGGTTTACAACAAATTTGCCCCCTCGTACCATTCCGTGTGGAGCAATTCGGAGCTCTCT
GAGATGCAAAAGTACCTTACTACCAATTGGGACTATTCGGGTACAGTTCTTGATGTTGCATGTGGGACTGGTGGA
TTTGGGCAGTTTCTCCATGCTCAAGGGATCCAAGCCGAGGTGACTGGCATTGACCTATCACCCGGCATGTTGGAA
AACGTGGAACATTACAGGGAACTTCGAGTTGGGCCAATGGAGGAGCAGATCATGGGTGCTGGTGAATATGACCAT
ATCGTATGCTTTGGTGCCCTCCATTTCCTTGGTCCTGTCTACCTCAATGCTGTGCTCGCACGGATGTTTATGCTT
GCACGCAAATCGGTTTCGATCTCGGTAGACGACGTCAGCGACGAATATATCCAGGCAATCAAAGAGAAGCATGGT
GAATTGACGTTTAATGCCAATCATGTCAAGGCCATTGAAGAGTTCGGAATTCCAAAAGGATGGAAACGAGTCTAT
CACGAGAGGAGGCTTATGTATTCTTCTCCAACCAATGGAGAGAAGGTTTATGGATATGGGATGCGCTTTGAGAGA
GCAGATGCCTAG
Transcript >Pro_DTO377G3_2|g3754.t1
ATGAAGATTTGTTTGATTAATTCGTCATACGAAGGAGTTGACTCCCCTTTCGAGAAGTATGATGACTTTCCCGAC
CCTAATCGGTATATTCCAAAAGACCGGCATGAGTTTTTCACTCGTTACGTCACCAAGAGAAATGCTGAGGCGGAG
ATTGACGAGATTTGCAAAGAACATTTTGATATGTTCATGAATTACATGTGGGGCATCGAAACCGACGATGTGGCA
GGAGTTGAAGCCACCAGATACCTCGAAACCAAGGGTGTTCCCATCCTCACCAACCCATCGACATTTCTAGCAAAG
AATAAAGTCGATCTCCAGAGGGCCGCTGAGAAAACAGGTCTCCGTGTTCCCGAAAACACCCCAGGGAAATACCCC
AAAATTGTCAAGTACTCTGACGGATATGGTTCGTTGAGTCTGGATGAGGCATCAATCTGCTACACGGAGAAAGAA
GTGACGGATCGCGTGGCCCTTTTGCAGGAGAAAGAAACACCCTTTGGCATCATCGTCCAGGATTATATCATCGGC
CGGGAATGTTCTGCTATAGTTGTGGAAATGGGAAAGGAGGTGGTGGCATTGACACCGCTGCAATATGTCTTTCCG
AAAGACACTCCCGACAACGAAGCCTTCTTGACGTGGTATAACAAATTCGAAGCTGTTGATAAAGGCACCATCAAA
TATGCATTTGTGGAAGAGCAGCCTCACATCAAAAACCTCCAGAATGCGGCTGTGGACGCATTCAAAGCAATTGGT
GTCAGCGGTGGTGGTGGGTGGGCCCGTGTTGATATGCGTCTGGAGGAAAGAACCGGGCTTGTCTACGTGATTGAA
GTCAATTGTATCCCCGTGGTCTTTTACCCAAAGGGAAACACACTTGGTGATGACCTTGTTGTGGGAGAGAGATTT
CCTGGTGGCCAGGCTGCATTTTTTGACATGTTACTAGCGACCAAGCAGATGCAGCTTGGGTGGCACCGTGTTCAA
AATGCTCATGTCGCCGAGGTTTACAACAAATTTGCCCCCTCGTACCATTCCGTGTGGAGCAATTCGGAGCTCTCT
GAGATGCAAAAGTACCTTACTACCAATTGGGACTATTCGGGTACAGTTCTTGATGTTGCATGTGGGACTGGTGGA
TTTGGGCAGTTTCTCCATGCTCAAGGGATCCAAGCCGAGGTGACTGGCATTGACCTATCACCCGGCATGTTGGAA
AACGTGGAACATTACAGGGAACTTCGAGTTGGGCCAATGGAGGAGCAGATCATGGGTGCTGGTGAATATGACCAT
ATCGTATGCTTTGGTGCCCTCCATTTCCTTGGTCCTGTCTACCTCAATGCTGTGCTCGCACGGATGTTTATGCTT
GCACGCAAATCGGTTTCGATCTCGGTAGACGACGTCAGCGACGAATATATCCAGGCAATCAAAGAGAAGCATGGT
GAATTGACGTTTAATGCCAATCATGTCAAGGCCATTGAAGAGTTCGGAATTCCAAAAGGATGGAAACGAGTCTAT
CACGAGAGGAGGCTTATGTATTCTTCTCCAACCAATGGAGAGAAGGTTTATGGATATGGGATGCGCTTTGAGAGA
GCAGATGCCTAG
Gene >Pro_DTO377G3_2|g3754.t1
ATGAAGATTTGTTTGATTAATTCGTCATACGAAGGAGTTGACTCCCCTTTCGAGAAGGTATGTCTACCCTATTGA
GGCCTTCTCCCAGCATCTCTAACTTCAAAACAGTATGATGACTTTCCCGACCCTAATCGGTATATTCCAAAAGAC
CGGCATGAGTTTTTCACTCGTTACGTCACCAAGAGAAATGCTGAGGCGGAGATTGACGAGATTTGCAAAGAACAT
TTTGATATGTTCATGAATTACATGGTGAATCCCGACTTTTAGATGCCCTCTATTCCTGGACTATACTTACAGATC
TCTTTTTCAGTGGGGCATCGAAACCGACGATGTGGCAGGAGTTGAAGCCACCAGATACCTCGAAACCAAGGGTGT
TCCCATCCTCACCAACCCATCGACATTTCTAGCAAAGAATAAAGTCGATCTCCAGAGGGCCGCTGAGAAAACAGG
TCTCCGTGTTCCCGAAAACACCCCAGGGAAATACCCCAAAATTGTCAAGTACTCTGACGGATATGGTTCGTTGAG
TCTGGATGAGGCATCAATCTGCTACACGGAGAAAGAAGTGACGGATCGCGTGGCCCTTTTGCAGGAGAAAGAAAC
ACCCTTTGGCATCATCGTCCAGGATTATATCATCGGCCGGGAATGTTCTGCTATAGTTGTGGAAATGGGAAAGGA
GGTGGTGGCATTGACACCGCTGCAATATGTCTTTCCGAAAGACACTCCCGACAACGAAGCCTTCTTGACGTGGTA
TAACAAATTCGAAGCTGTTGATAAAGGCACCATCAAATATGCATTTGTGGAAGAGCAGCCTCACATCAAAAACCT
CCAGAATGCGGCTGTGGACGCATTCAAAGCAATTGGTGTCAGCGGTGGTGGTGGGTGGGCCCGTGTTGATATGCG
TCTGGAGGAAAGAACCGGGCTTGTCTACGTGATTGAAGTCAATTGTATCCCCGTGGTCTTTTACCCAAAGGGAAA
CACACTTGGTGATGACCTTGTTGTGGGAGAGAGATTTCCTGGTGGCCAGGCTGCATTTTTTGACATGTTACTAGC
GACCAAGCAGATGCAGCTTGGGTGGCACCGTGTTCAAAATGCTCATGTCGCCGAGGTTTACAACAAATTTGCCCC
CTCGTACCATTCCGTGTGGAGCAATTCGGAGCTCTCTGAGATGCAAAAGTACCTTACTACCAATTGGGACTATTC
GGGTACAGTTCTTGATGTTGCATGTGGGACTGGTGGATTTGGGCAGTTTCTCCATGCTCAAGGGATCCAAGCCGA
GGTGACTGGCATTGACCTATCACCCGGCATGTTGGAAAACGTGGAACATTACAGGGAACTTCGAGTTGGGCCAAT
GGAGGAGCAGATCATGGTATGTGCCTTTGGAATACTTGTTTTGGGAAAAATGAATGAAGACAAAGCTTACTTTAA
TATTAGGGTGCTGGTGAATATGACCATATCGTATGCTTTGGTGCCCTCCATTTCCTTGGTCCTGTCTACCTCAAT
GCTGTGCTCGCACGGATGTTTATGCTTGCACGCAAATCGGTTTCGATCTCGGTAGACGACGTCAGCGACGAATAT
ATCCAGGCAATCAAAGAGAAGCATGGTGAATTGACGTTTAATGCCAATCATGTCAAGGCCATTGAAGAGTTCGGA
ATTCCAAAAGGATGGAAACGAGTCTATCACGAGAGGAGGCTTATGTATTCTTCTCCAACCAATGGAGAGAAGGTT
TATGGATATGGGATGCGCTTTGAGAGAGCAGATGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail