Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3749.t1
Gene name
Locationscaffold_06:643310..645212
Strand+
Gene length (bp)1902
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-48 106 515

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 99 121 22
2 136 158 22
3 165 187 22
4 191 213 22
5 225 247 22
6 251 273 22
7 337 359 22
8 379 401 22
9 439 458 19
10 468 490 22
11 503 522 19
12 526 548 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3749.t1
MELHLTEGTREGKTVTVPGPFQHTPVDRNIRRVDSGYGGFDEAPVAAPTTHTSPSDANNDHIQPEDSGSPATEPH
IESTETAPDNSQPSFSAFSKYERSFIVMMVTLASFFSPLSGQIYYPVMPTLVRNYHLTPELINLTVTTYMIFQGL
VPSFMGTFADTGGRRPAYVIAFAVYTAANIGLALQNSFAALIVLRCLQSAGSSGTVAFGYGVIADITTTAERGKY
IGPMAAGVMVAPALGPVIGGLLAKFLGWRSVFWFLVIVSGGYLVFYVLTMPETARKIVGDGRAVPNEWWRRSVIQ
WWSKRQTQSEERQTDAEGSQQQSSHTKRLRFPNPLSSFVILLEWDALIIISYVGIVMFANIALLTSTPNLFGPLY
GFSELQIGLCFLPLGVSSCLGAVLYGKVIDYNYKRTAQKLGFPVNRQKGDDLRSFPIEHTRLQTVFPAMAIGVVA
FIPYGWVLQQRVHLAAPLVLQFIIGFCFVAALNCLNTLLVDLFPDKPATAASACNLVRCCLGAVGAAVISQMLSG
MGWGWCFFFLGLAMTAGMGLLWVENVYGMGWREKRLLKIEQKMEKDARAAEIQIEGKADGREQKDTNVQELVAGA
NDANVAEEPRRTE*
Coding >Pro_DTO377G3_2|g3749.t1
ATGGAGCTGCACCTGACTGAAGGAACTCGCGAGGGAAAGACAGTGACAGTACCTGGTCCCTTCCAGCACACCCCG
GTAGATCGCAATATAAGGCGAGTCGATAGTGGATATGGCGGGTTTGATGAAGCACCCGTCGCAGCCCCAACCACA
CATACATCCCCCAGCGATGCCAACAACGACCATATTCAACCCGAAGACTCAGGCTCGCCAGCTACCGAGCCACAT
ATCGAGAGCACAGAAACAGCACCGGACAATTCCCAGCCATCATTTTCGGCATTCAGCAAATACGAAAGGTCATTC
ATCGTGATGATGGTGACTCTTGCGTCGTTCTTCTCCCCACTTTCCGGTCAAATCTACTACCCGGTCATGCCAACA
TTGGTACGGAATTACCACCTTACACCCGAGCTGATCAACCTGACAGTCACAACATATATGATCTTCCAAGGCCTA
GTCCCGAGCTTCATGGGCACATTCGCCGACACCGGGGGTAGACGTCCAGCATATGTCATTGCGTTCGCAGTGTAC
ACCGCTGCTAACATCGGACTGGCGTTACAAAACAGTTTCGCGGCGTTGATTGTCCTCCGCTGTCTCCAGAGCGCA
GGGAGCAGCGGCACCGTGGCCTTTGGATATGGTGTTATAGCGGACATTACGACAACAGCAGAGCGTGGGAAATAT
ATCGGGCCTATGGCTGCAGGTGTTATGGTTGCGCCTGCGCTGGGCCCTGTTATCGGTGGTCTTTTGGCCAAATTC
CTCGGCTGGCGCAGTGTCTTCTGGTTCCTGGTCATTGTTAGTGGAGGGTACTTGGTGTTCTATGTGCTTACTATG
CCGGAGACGGCACGCAAAATTGTTGGTGACGGCCGTGCAGTACCGAACGAGTGGTGGCGCAGGTCGGTTATCCAA
TGGTGGTCGAAGAGGCAGACACAGTCTGAGGAAAGGCAAACTGATGCAGAAGGGTCGCAACAACAGTCCTCGCAT
ACTAAGAGACTTAGGTTCCCGAATCCTCTCAGCTCCTTTGTCATTCTACTGGAGTGGGATGCCTTGATCATCATC
TCGTACGTCGGGATTGTGATGTTCGCGAATATCGCTCTGTTAACAAGCACTCCTAATCTCTTTGGTCCCCTGTAT
GGATTCAGCGAGCTCCAGATTGGGCTCTGTTTCTTGCCCCTCGGGGTAAGCTCTTGCCTCGGCGCAGTCCTGTAT
GGAAAAGTCATTGACTACAACTACAAGCGGACAGCCCAAAAGCTCGGATTTCCAGTGAACCGCCAGAAAGGGGAC
GATTTGCGCAGTTTTCCGATCGAGCACACTCGCCTGCAAACAGTATTCCCCGCAATGGCCATCGGCGTTGTAGCA
TTCATCCCGTACGGGTGGGTGCTGCAGCAAAGAGTACACTTAGCCGCTCCACTGGTGCTGCAATTCATTATAGGA
TTCTGCTTCGTTGCGGCCCTGAACTGCCTCAACACCCTTCTTGTCGACCTATTCCCAGACAAGCCTGCCACAGCT
GCATCGGCATGCAACCTTGTTCGCTGCTGCCTTGGCGCTGTTGGTGCCGCGGTCATTAGCCAAATGCTAAGTGGC
ATGGGATGGGGATGGTGTTTCTTTTTCTTGGGCTTGGCCATGACTGCTGGAATGGGGCTGCTCTGGGTTGAGAAT
GTGTATGGGATGGGCTGGAGAGAGAAGAGGTTGCTCAAGATCGAACAGAAGATGGAGAAGGATGCGAGAGCTGCT
GAGATTCAGATCGAAGGAAAGGCCGATGGGAGAGAACAGAAGGATACTAATGTTCAGGAATTGGTTGCTGGTGCT
AATGATGCTAATGTCGCTGAAGAACCTAGAAGAACGGAGTGA
Transcript >Pro_DTO377G3_2|g3749.t1
ATGGAGCTGCACCTGACTGAAGGAACTCGCGAGGGAAAGACAGTGACAGTACCTGGTCCCTTCCAGCACACCCCG
GTAGATCGCAATATAAGGCGAGTCGATAGTGGATATGGCGGGTTTGATGAAGCACCCGTCGCAGCCCCAACCACA
CATACATCCCCCAGCGATGCCAACAACGACCATATTCAACCCGAAGACTCAGGCTCGCCAGCTACCGAGCCACAT
ATCGAGAGCACAGAAACAGCACCGGACAATTCCCAGCCATCATTTTCGGCATTCAGCAAATACGAAAGGTCATTC
ATCGTGATGATGGTGACTCTTGCGTCGTTCTTCTCCCCACTTTCCGGTCAAATCTACTACCCGGTCATGCCAACA
TTGGTACGGAATTACCACCTTACACCCGAGCTGATCAACCTGACAGTCACAACATATATGATCTTCCAAGGCCTA
GTCCCGAGCTTCATGGGCACATTCGCCGACACCGGGGGTAGACGTCCAGCATATGTCATTGCGTTCGCAGTGTAC
ACCGCTGCTAACATCGGACTGGCGTTACAAAACAGTTTCGCGGCGTTGATTGTCCTCCGCTGTCTCCAGAGCGCA
GGGAGCAGCGGCACCGTGGCCTTTGGATATGGTGTTATAGCGGACATTACGACAACAGCAGAGCGTGGGAAATAT
ATCGGGCCTATGGCTGCAGGTGTTATGGTTGCGCCTGCGCTGGGCCCTGTTATCGGTGGTCTTTTGGCCAAATTC
CTCGGCTGGCGCAGTGTCTTCTGGTTCCTGGTCATTGTTAGTGGAGGGTACTTGGTGTTCTATGTGCTTACTATG
CCGGAGACGGCACGCAAAATTGTTGGTGACGGCCGTGCAGTACCGAACGAGTGGTGGCGCAGGTCGGTTATCCAA
TGGTGGTCGAAGAGGCAGACACAGTCTGAGGAAAGGCAAACTGATGCAGAAGGGTCGCAACAACAGTCCTCGCAT
ACTAAGAGACTTAGGTTCCCGAATCCTCTCAGCTCCTTTGTCATTCTACTGGAGTGGGATGCCTTGATCATCATC
TCGTACGTCGGGATTGTGATGTTCGCGAATATCGCTCTGTTAACAAGCACTCCTAATCTCTTTGGTCCCCTGTAT
GGATTCAGCGAGCTCCAGATTGGGCTCTGTTTCTTGCCCCTCGGGGTAAGCTCTTGCCTCGGCGCAGTCCTGTAT
GGAAAAGTCATTGACTACAACTACAAGCGGACAGCCCAAAAGCTCGGATTTCCAGTGAACCGCCAGAAAGGGGAC
GATTTGCGCAGTTTTCCGATCGAGCACACTCGCCTGCAAACAGTATTCCCCGCAATGGCCATCGGCGTTGTAGCA
TTCATCCCGTACGGGTGGGTGCTGCAGCAAAGAGTACACTTAGCCGCTCCACTGGTGCTGCAATTCATTATAGGA
TTCTGCTTCGTTGCGGCCCTGAACTGCCTCAACACCCTTCTTGTCGACCTATTCCCAGACAAGCCTGCCACAGCT
GCATCGGCATGCAACCTTGTTCGCTGCTGCCTTGGCGCTGTTGGTGCCGCGGTCATTAGCCAAATGCTAAGTGGC
ATGGGATGGGGATGGTGTTTCTTTTTCTTGGGCTTGGCCATGACTGCTGGAATGGGGCTGCTCTGGGTTGAGAAT
GTGTATGGGATGGGCTGGAGAGAGAAGAGGTTGCTCAAGATCGAACAGAAGATGGAGAAGGATGCGAGAGCTGCT
GAGATTCAGATCGAAGGAAAGGCCGATGGGAGAGAACAGAAGGATACTAATGTTCAGGAATTGGTTGCTGGTGCT
AATGATGCTAATGTCGCTGAAGAACCTAGAAGAACGGAGTGA
Gene >Pro_DTO377G3_2|g3749.t1
ATGGAGCTGCACCTGACTGAAGGAACTCGCGAGGGAAAGACAGTGACAGTACCTGGTCCCTTCCAGCACACCCCG
GTAGATCGCAATATAAGGCGAGTCGATAGTGGATATGGCGGGTTTGATGAAGCACCCGTCGCAGCCCCAACCACA
CATACATCCCCCAGCGATGCCAACAACGACCATATTCAACCCGAAGACTCAGGCTCGCCAGCTACCGAGCCACAT
ATCGAGAGCACAGAAACAGCACCGGACAATTCCCAGCCATCATTTTCGGCATTCAGCAAATACGAAAGGTCATTC
ATCGTGATGATGGTGACTCTTGCGTCGTTCTTCTCCCCACTTTCCGGTCAAATCTACTACCCGGTCATGCCAACA
TTGGTACGGAATTACCACCTTACACCCGAGCTGATCAACCTGACAGTCACAACATATATGATCTTCCAAGGCCTA
GTCCCGAGCTTCATGGGCACATTCGCCGACACCGGGGGTAGACGTCCAGCATATGTCATTGCGTTCGCAGTGTAC
ACCGCTGCTAACATCGGACTGGCGTTACAAAACAGTTTCGCGGCGTTGATTGTCCTCCGCTGTCTCCAGAGCGCA
GGGAGCAGCGGCACCGTGGCCTTTGGATATGGTGTTATAGCGGACATTACGACAACAGCAGAGCGTGGGAAATAT
ATCGGGCCTATGGCTGCAGGTGTTATGGTTGCGCCTGCGCTGGGCCCTGTTATCGGTGGTCTTTTGGCCAAATTC
CTCGGCTGGCGCAGTGTCTTCTGGTTCCTGGTCATTGTTAGTGGAGGGTACTTGGTGTTCTATGTGCTTACTATG
CCGGAGACGGCACGCAAAATTGTTGGTGACGGCCGTGCAGTACCGAACGAGTGGTGGCGCAGGTCGGTTATCCAA
TGGTGGTCGAAGAGGCAGACACAGTCTGAGGAAAGGCAAACTGATGCAGAAGGGTCGCAACAACAGTCCTCGCAT
ACTAAGAGACTTAGGTTCCCGAATCCTCTCAGCTCCTTTGTCATTCTACTGGAGTGGGATGCCTTGATCATCATC
TCGTACGTCGGGATTGTGATGTTCGCGAATATCGCTCTGTTAACAAGCACTCCTAATCTCTTTGGTCCCCTGTAT
GGATTCAGCGAGCTCCAGATTGGGCTCTGTTTCTTGTAAGTCTTCATGTCTGCCTCATCTTCCTGACCCCGGGGT
CCATACTAACAAACTCGCAGGCCCCTCGGGGTAAGCTCTTGCCTCGGCGCAGTCCTGTATGGAAAAGTCATTGAC
TACAACTACAAGCGGACAGCCCAAAAGCTCGGATTTCCAGTGAACCGCCAGAAAGGGGACGATTTGCGCAGTTTT
CCGATCGAGCACACTCGCCTGCAAACAGTATTCCCCGCAATGGCCATCGGCGTTGTAGCATTCATCCCGTACGGG
TGGGTGCTGCAGCAAAGAGTACACTTAGCCGCTCCACTGGTGCTGCAATTCATTATAGGATTCTGCTTCGTTGCG
GCCCTGAACTGCCTCAACACCCTTCTTGTCGACCTATTCCCAGACAAGCCTGCCACAGCTGCATCGGCATGCAAC
CTTGTTCGCTGCTGCCTTGGCGCTGTTGGTGCCGCGGTCATTAGCCAAATGCTAAGTGGCATGGGATGGGGATGG
TGTTTCTTTTTCTTGGGCTTGGCCATGACTGCTGGAATGGGGCTGCTCTGGGTTGAGAATGTGTATGGGATGGGC
TGGAGAGAGAAGAGGTTGCTCAAGATCGAACAGAAGATGGAGAAGGATGCGAGAGCTGCTGAGATTCAGATCGAA
GGAAAGGCCGATGGGAGAGAACAGAAGGATACTAATGTTCAGGAATTGGTTGCTGGTGCTAATGATGCTAATGTC
GCTGAAGAACCTAGAAGAACGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail