Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3748.t1
Gene name
Locationscaffold_06:635525..642345
Strand+
Gene length (bp)6820
Transcript length (bp)5961
Coding sequence length (bp)5961
Protein length (aa) 1987

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12110 Nup96 Nuclear protein 96 2.7E-81 1505 1816
PF04096 Nucleoporin2 Nucleoporin autopeptidase 1.0E-50 914 1060

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005643 nuclear pore Yes
GO:0006913 nucleocytoplasmic transport Yes
GO:0005575 cellular_component No
GO:0044464 cell part No
GO:0003674 molecular_function No
GO:0051649 establishment of localization in cell No
GO:0044446 intracellular organelle part No
GO:0044428 nuclear part No
GO:0005198 structural molecule activity No
GO:0051179 localization No
GO:0044422 organelle part No
GO:0044424 intracellular part No
GO:0046907 intracellular transport No
GO:0051169 nuclear transport No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0051641 cellular localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3748.t1
MSFGFGGFGSNNQSSGFGTGTGFGAGTSTGGGFGSTASPFGGATTGTSSAFGSTPSTSTGFGTGGGFGTNTTPQQ
PNALFGGQTRPGGFGTPNTPNTGSLFGGGTQTAGTTGGFGAGGGFGSTGTTGGFGANASATPAGGSLFGGAKPTG
FGTATGTSAFGTSGGFGSTAAPTTTPSTGFGGSGTAFQGGLPNCEGTGSTPFSPWNEKDTSSANTTNHYQSICFM
QPYSKWSFEELRLADYQQGRRFGNGSGQAGGFGAPAFGNTTTGGFGQQNTTATPAFGASTTPFGGAATSAPTGFG
ATQTAGGFGSTGANPLFGSAAKPATSLFGGTTPAASSGSLFGGATQTAGGFGGNTGTGSAFGNTGGSLFGSNNQQ
QQNKPAFGATGTTGGAFGGFGNTQTTTAANPFGAPTATASPFGGGAQQQAPSAFGGFGGANQQNQAQTQPKSLFG
GFGGTPQQGAGTGLLGGAGSTPAAGSSLFGGAQQQPQQQGGSSLFGGQNQQAGTGSTLFGGSQNQQKPGGLFGST
PAPTTGGFSGFGASQPQPAAGGSSLFNTQNQQQQKPGGLFSSTTGTGGGGMFGGGQTNTGQGAGSSLFGGQNQQP
QGGLGVSAFGASMPGQQSQPAPGSFQASLLDGNPYGSQSIFSGLPAPGGSAPGPLATPLSSSMKQKQRTPLPVYR
ITPNAANRLITPPKRGYGFSYSTYGSPSGSTGASSGLGSSLLGGAGGSSSLRGSVNGSIGRSFSKSYSTSNLRKT
FDPEADSILSPGALQAGSVRGNSSLKRLTINRGLRNEIFSTSRIAPAPLHTPAPLLTNGEDAHSSDKLKKKVSFD
SHTSGVNGGELVHVEPNSSEPSAEELGFLRSVRKSGSLNGFDAAGTSDRPEAESARRDLAVVPESAPQTTNGATV
KRLTFIPGGDPRPGEYWMQPSRAELSRMSRDQLRQVVDFTVGRQNCGSVTFNGPVDLTTVDLDNLFSNIVDIGLR
KITVYPEESVKPARGKGLNVPSTLRIENSWPRGRDKKSNSPVTSGPLFDKHIDRLQKVGDTEFVNYETETGTWVF
KVPHFTTYGLDYDEEEGESHDQSTMSAQGPDHATSRAHFDLASFDQSTFSIDESFVGSMIGVEDDTFDFKKRKLV
PGSFANQAMPVEDDYFSDGETESFLEEGSTGSTTENDDDVVTESQQSGDSVVGSDEADEMDMAGAFPTPHRTVER
NDYQSTNGDLDTTYHMSRHFGSPAKPQLDLSGDWAEQLQRTISPRKQNRDALREMQASAFIDRNLVNDESPTNIA
TASPKKGFSNSIDLMNSLFQQPRKQAAPSPLKAKATPKGFEWPYNKQPKTFAGDTTQMSESDAAFHDSFKPRWGP
MDSLICVKNDMGDTILGVNQTWKESFSIFSEDRDIAVMTYNQSSEVREMLDVQRLQSSIQRIDGTPFVRMARIDL
SQFPLSPSTRSQSEEERLVWQLLNILFNDDIEDDISAGVPPRLRQQFAHRIRKDRLTRLWEGIIREKHSQNLDAI
RSPVERAVHLICSHRVEEACKTLIDSQNPHLATIVAQIGRDATSRADIANQIDVWRQNNILSEMTEPIRALYELV
AGNALRSEGKSGGALEDRASSFGFTERFDLDWFQAFGLRLWYCTAEDEPIEVAVSKFLADLATGQEPAFPHPSHQ
ASTRAVPQPGSDTLGRESPLWVLLKAFSAIQGHVTQPVEFPASFLPESVSGDRLSNRLSFQLHHVLAAVVGKNQA
IKINQHQTDQLVRDFASELSAGGKLDQALFVLLHLSQGNDRKGAVQETLARFAAQLPEPFAADGSSDLAWQYLIT
DLQLPEAWIWVAKALYARDIGDSAREVDCLIRGKHWNDAHTTFCRIVGPSTIIEGDYRTLETLVSGFGDAPERKM
RGWSSGGGVYEDFLRLVNSTSGRRDPIRLNRLVNALVAMGDRVQGSSLEGLEERVAFKEMSRAVAGWITHEDVHS
VESSAVLGLPLTGDARVLQTAEMSRRYYGVIMAGGY*
Coding >Pro_DTO377G3_2|g3748.t1
ATGTCTTTCGGATTTGGAGGGTTCGGTTCGAACAACCAAAGCAGCGGCTTTGGTACTGGCACTGGCTTCGGAGCT
GGCACCAGCACTGGTGGAGGCTTTGGCTCGACAGCTTCCCCGTTCGGAGGTGCTACTACTGGCACTTCAAGCGCC
TTCGGTAGCACCCCTAGCACATCTACTGGCTTCGGCACTGGCGGAGGATTCGGAACCAATACTACACCCCAACAA
CCTAATGCCCTTTTCGGCGGCCAAACTCGCCCCGGTGGATTCGGCACCCCCAACACTCCTAACACCGGGTCTCTC
TTCGGAGGAGGCACTCAGACTGCTGGTACCACCGGCGGCTTCGGTGCTGGTGGAGGATTCGGTTCTACCGGTACC
ACTGGCGGCTTTGGCGCCAATGCCAGCGCAACCCCTGCGGGTGGAAGCCTTTTCGGTGGTGCCAAACCTACGGGC
TTTGGCACTGCTACCGGTACCAGCGCATTCGGCACTAGCGGTGGCTTCGGATCTACCGCTGCCCCCACCACAACC
CCCAGCACAGGTTTCGGCGGCTCAGGTACTGCTTTCCAAGGAGGTCTACCTAACTGCGAAGGTACTGGCAGCACC
CCGTTCAGTCCCTGGAACGAGAAGGATACCAGCTCAGCCAACACCACGAACCACTACCAAAGCATCTGTTTTATG
CAACCCTACAGTAAATGGTCTTTCGAGGAACTGCGCCTAGCGGATTACCAACAAGGTCGTCGTTTCGGCAACGGC
AGTGGCCAAGCCGGTGGTTTTGGCGCTCCTGCTTTCGGTAACACTACAACCGGTGGATTTGGTCAACAAAATACA
ACAGCTACTCCTGCCTTTGGCGCTAGCACCACTCCGTTCGGAGGGGCTGCCACAAGTGCGCCAACCGGCTTCGGT
GCAACCCAGACTGCCGGTGGATTCGGCTCCACTGGTGCTAATCCCTTGTTCGGTTCAGCAGCCAAACCAGCAACT
TCCTTATTCGGTGGAACTACTCCTGCAGCTTCATCAGGAAGCCTCTTTGGGGGAGCCACACAGACCGCTGGTGGC
TTCGGAGGCAACACCGGTACTGGATCGGCTTTCGGCAACACCGGCGGGTCTTTGTTCGGTAGTAACAACCAGCAA
CAGCAGAACAAGCCCGCCTTTGGCGCCACTGGTACAACTGGTGGCGCCTTCGGTGGTTTCGGTAATACCCAAACA
ACCACTGCCGCGAATCCGTTCGGAGCTCCGACCGCCACAGCCTCACCCTTTGGTGGTGGTGCTCAGCAGCAAGCA
CCAAGTGCCTTCGGTGGTTTCGGTGGTGCAAACCAACAGAATCAAGCTCAAACCCAACCCAAGTCATTGTTCGGC
GGATTTGGGGGCACCCCGCAACAGGGAGCCGGAACAGGTTTGCTCGGCGGTGCTGGCAGCACTCCAGCTGCTGGA
TCTTCGCTCTTCGGTGGAGCCCAGCAGCAACCCCAGCAGCAGGGAGGTAGCTCACTCTTCGGTGGCCAAAATCAG
CAAGCTGGTACCGGAAGTACGCTATTTGGCGGTTCACAGAATCAACAAAAGCCCGGTGGTCTCTTCGGATCTACC
CCAGCTCCCACCACGGGTGGTTTCTCTGGCTTTGGTGCCTCGCAGCCCCAGCCAGCTGCTGGCGGTAGTAGCTTG
TTCAACACGCAGAACCAACAGCAGCAGAAGCCTGGTGGTCTCTTTTCCTCGACTACGGGAACTGGTGGTGGCGGC
ATGTTCGGCGGCGGCCAAACCAACACGGGCCAAGGCGCCGGCTCTTCGCTCTTCGGTGGTCAAAACCAGCAACCG
CAGGGTGGCCTAGGTGTCAGTGCTTTCGGTGCCTCAATGCCCGGACAACAGTCTCAGCCTGCCCCTGGTAGCTTC
CAAGCGTCGCTTCTTGATGGAAACCCGTATGGAAGTCAGTCCATCTTCTCTGGTCTTCCTGCCCCTGGTGGATCG
GCTCCCGGTCCCCTTGCCACGCCACTGTCTTCCAGCATGAAGCAAAAGCAGCGAACTCCGTTGCCGGTCTACAGA
ATTACTCCCAACGCTGCCAATCGACTCATCACCCCTCCAAAGCGTGGATATGGTTTCTCCTATTCTACCTATGGC
TCGCCATCTGGCAGCACTGGTGCCTCATCTGGTCTTGGTAGTAGTTTGTTGGGTGGTGCTGGGGGCAGTAGCAGT
CTCCGCGGCAGCGTCAATGGCAGCATTGGACGTAGCTTCAGCAAGAGTTACTCCACTAGCAACCTTCGCAAGACC
TTCGATCCAGAGGCGGACAGCATTCTTTCTCCCGGTGCCCTGCAGGCTGGCAGCGTACGTGGTAACAGCAGTCTG
AAGCGTCTCACTATCAACCGTGGTCTGAGAAATGAAATATTCTCGACCTCTCGCATTGCCCCGGCCCCTCTTCAC
ACCCCGGCCCCCCTGCTCACTAACGGAGAAGATGCCCATTCTTCCGACAAGCTGAAGAAAAAGGTCAGCTTCGAC
TCTCATACCTCCGGGGTCAATGGCGGAGAACTTGTTCACGTTGAACCTAACAGTTCCGAGCCCTCTGCTGAGGAG
CTTGGGTTCCTTCGCTCTGTGCGTAAGAGCGGTAGCCTGAATGGTTTCGATGCTGCCGGCACTTCTGATCGTCCC
GAGGCCGAATCTGCCCGCCGTGACCTTGCCGTTGTCCCCGAAAGTGCACCGCAAACCACCAACGGTGCTACTGTT
AAGCGTCTTACGTTCATCCCCGGTGGTGACCCAAGACCTGGTGAGTACTGGATGCAACCTTCCCGTGCCGAGCTT
AGCAGGATGAGCCGCGACCAGCTCAGACAAGTCGTTGACTTCACCGTTGGCCGTCAGAACTGTGGTTCTGTTACT
TTCAACGGCCCCGTTGATCTGACTACCGTTGATCTGGACAATCTTTTCTCCAATATTGTGGATATTGGTCTTCGC
AAGATTACTGTCTACCCCGAGGAATCGGTCAAGCCTGCCAGGGGCAAGGGACTGAACGTGCCATCTACCCTACGG
ATTGAGAACTCTTGGCCCCGTGGTAGAGATAAGAAGAGCAACTCGCCTGTCACTAGTGGTCCTCTGTTTGACAAA
CACATTGATCGTCTGCAGAAAGTGGGCGATACCGAGTTCGTTAACTACGAAACTGAGACTGGAACCTGGGTTTTC
AAGGTGCCTCATTTCACTACATATGGCCTTGACTACGATGAAGAGGAAGGTGAGAGTCACGACCAAAGCACCATG
AGTGCCCAAGGCCCTGACCACGCTACCAGCAGGGCTCACTTCGACCTCGCGTCTTTCGATCAGTCTACCTTTTCT
ATCGATGAGTCCTTCGTCGGTTCCATGATTGGTGTTGAAGACGATACTTTCGACTTCAAAAAGCGCAAGCTTGTT
CCTGGCTCTTTCGCTAACCAGGCCATGCCTGTGGAGGATGATTATTTTTCTGACGGTGAAACCGAGTCTTTTTTA
GAGGAAGGCTCCACGGGTTCGACTACTGAGAATGACGACGACGTCGTCACCGAGAGCCAACAGTCTGGCGATTCG
GTAGTTGGATCAGATGAGGCAGATGAAATGGATATGGCCGGTGCCTTTCCTACTCCTCATCGCACCGTGGAGCGG
AACGACTATCAGAGCACCAATGGTGACCTGGATACCACTTACCATATGTCAAGACACTTCGGCAGTCCCGCAAAG
CCTCAGCTTGATCTTAGTGGCGACTGGGCCGAGCAGCTGCAGCGTACCATCAGCCCTCGCAAGCAGAACCGTGAT
GCCTTGCGTGAAATGCAGGCAAGCGCTTTCATTGATCGTAACCTCGTGAACGATGAATCTCCCACAAACATTGCG
ACAGCATCTCCGAAGAAAGGCTTCTCAAACAGCATTGATCTTATGAACTCTTTGTTCCAGCAGCCGCGCAAGCAA
GCCGCCCCTTCTCCGCTGAAGGCTAAAGCAACGCCAAAGGGCTTTGAGTGGCCTTACAACAAGCAACCCAAGACC
TTCGCTGGCGATACAACACAAATGAGCGAATCCGATGCCGCTTTCCATGACTCTTTCAAACCCCGCTGGGGTCCC
ATGGATTCCCTCATCTGTGTCAAAAATGATATGGGGGACACAATCCTAGGGGTGAACCAGACCTGGAAAGAAAGC
TTCTCCATTTTCAGCGAAGACCGTGATATTGCAGTCATGACATACAACCAATCTAGCGAGGTCAGGGAAATGCTT
GATGTCCAGCGGCTTCAGTCCTCTATCCAGCGCATTGATGGCACCCCTTTCGTTCGTATGGCCAGGATCGACCTG
TCGCAGTTCCCTCTGTCACCATCCACCCGTTCCCAGTCGGAAGAAGAGCGCTTGGTGTGGCAGCTTCTCAACATT
CTTTTCAATGATGATATTGAGGACGATATCTCAGCGGGGGTACCGCCGCGCCTACGACAGCAATTTGCGCACCGG
ATCAGGAAGGACCGACTCACTCGTCTTTGGGAGGGAATCATTCGTGAAAAGCACTCCCAAAACCTGGATGCAATT
CGCTCCCCTGTGGAACGGGCCGTTCATTTGATCTGTTCGCACCGAGTGGAGGAAGCCTGTAAGACACTGATTGAC
AGTCAAAATCCCCATCTGGCGACTATAGTCGCACAGATTGGCCGCGATGCTACCTCGCGTGCCGACATAGCGAAC
CAAATCGATGTGTGGCGTCAGAACAACATACTCTCGGAGATGACTGAACCCATACGAGCCCTTTACGAACTGGTC
GCTGGGAATGCTCTCCGCAGCGAAGGCAAATCGGGCGGTGCGCTTGAAGACCGGGCCTCCAGCTTTGGCTTCACC
GAGCGGTTCGACCTAGATTGGTTCCAGGCCTTTGGTCTTCGTCTGTGGTATTGCACGGCTGAAGATGAGCCAATC
GAGGTAGCTGTCTCCAAGTTCCTTGCGGACTTGGCCACCGGACAAGAACCCGCCTTCCCCCACCCATCGCACCAG
GCTAGTACCCGTGCAGTCCCGCAGCCTGGCTCTGACACCCTTGGGCGCGAATCTCCTCTTTGGGTTCTGCTCAAG
GCCTTCTCGGCGATTCAAGGCCACGTCACCCAACCCGTTGAATTCCCCGCATCTTTCCTTCCCGAATCCGTCTCC
GGTGACCGTCTCTCCAACCGACTGTCCTTCCAGCTACACCACGTTCTCGCTGCGGTAGTCGGAAAAAACCAGGCC
ATCAAAATCAACCAGCACCAAACTGACCAACTCGTCCGGGATTTTGCTTCTGAACTCAGTGCAGGCGGAAAGCTT
GATCAAGCATTGTTTGTCCTCCTGCACCTCTCCCAAGGTAACGACCGAAAGGGCGCTGTCCAAGAAACTCTCGCC
CGCTTCGCCGCTCAACTCCCCGAGCCCTTCGCTGCCGACGGCTCCTCCGACCTGGCATGGCAATATCTCATCACT
GATCTCCAGCTTCCCGAAGCCTGGATCTGGGTTGCCAAGGCTCTGTATGCTCGCGACATCGGCGATTCTGCCCGT
GAGGTAGACTGTCTTATTCGCGGCAAGCACTGGAACGATGCCCACACCACCTTTTGTCGCATCGTCGGCCCAAGC
ACCATCATCGAGGGCGACTACCGTACCCTCGAAACTCTGGTCTCCGGCTTCGGTGACGCGCCTGAGCGTAAAATG
CGCGGCTGGTCTTCTGGCGGCGGCGTTTATGAAGATTTCCTCCGCCTTGTCAACTCCACCAGCGGCCGACGTGAT
CCAATTCGCCTGAACCGCCTAGTGAACGCTCTTGTTGCGATGGGCGATCGTGTCCAGGGATCCAGTCTGGAAGGA
CTGGAGGAGCGTGTTGCATTCAAGGAGATGAGCCGGGCTGTCGCCGGCTGGATTACACACGAAGATGTTCATTCC
GTTGAATCTTCCGCTGTCCTGGGCCTGCCCTTGACAGGTGACGCTCGCGTTTTGCAGACCGCAGAGATGAGCCGT
CGATACTACGGCGTCATCATGGCTGGTGGTTATTAA
Transcript >Pro_DTO377G3_2|g3748.t1
ATGTCTTTCGGATTTGGAGGGTTCGGTTCGAACAACCAAAGCAGCGGCTTTGGTACTGGCACTGGCTTCGGAGCT
GGCACCAGCACTGGTGGAGGCTTTGGCTCGACAGCTTCCCCGTTCGGAGGTGCTACTACTGGCACTTCAAGCGCC
TTCGGTAGCACCCCTAGCACATCTACTGGCTTCGGCACTGGCGGAGGATTCGGAACCAATACTACACCCCAACAA
CCTAATGCCCTTTTCGGCGGCCAAACTCGCCCCGGTGGATTCGGCACCCCCAACACTCCTAACACCGGGTCTCTC
TTCGGAGGAGGCACTCAGACTGCTGGTACCACCGGCGGCTTCGGTGCTGGTGGAGGATTCGGTTCTACCGGTACC
ACTGGCGGCTTTGGCGCCAATGCCAGCGCAACCCCTGCGGGTGGAAGCCTTTTCGGTGGTGCCAAACCTACGGGC
TTTGGCACTGCTACCGGTACCAGCGCATTCGGCACTAGCGGTGGCTTCGGATCTACCGCTGCCCCCACCACAACC
CCCAGCACAGGTTTCGGCGGCTCAGGTACTGCTTTCCAAGGAGGTCTACCTAACTGCGAAGGTACTGGCAGCACC
CCGTTCAGTCCCTGGAACGAGAAGGATACCAGCTCAGCCAACACCACGAACCACTACCAAAGCATCTGTTTTATG
CAACCCTACAGTAAATGGTCTTTCGAGGAACTGCGCCTAGCGGATTACCAACAAGGTCGTCGTTTCGGCAACGGC
AGTGGCCAAGCCGGTGGTTTTGGCGCTCCTGCTTTCGGTAACACTACAACCGGTGGATTTGGTCAACAAAATACA
ACAGCTACTCCTGCCTTTGGCGCTAGCACCACTCCGTTCGGAGGGGCTGCCACAAGTGCGCCAACCGGCTTCGGT
GCAACCCAGACTGCCGGTGGATTCGGCTCCACTGGTGCTAATCCCTTGTTCGGTTCAGCAGCCAAACCAGCAACT
TCCTTATTCGGTGGAACTACTCCTGCAGCTTCATCAGGAAGCCTCTTTGGGGGAGCCACACAGACCGCTGGTGGC
TTCGGAGGCAACACCGGTACTGGATCGGCTTTCGGCAACACCGGCGGGTCTTTGTTCGGTAGTAACAACCAGCAA
CAGCAGAACAAGCCCGCCTTTGGCGCCACTGGTACAACTGGTGGCGCCTTCGGTGGTTTCGGTAATACCCAAACA
ACCACTGCCGCGAATCCGTTCGGAGCTCCGACCGCCACAGCCTCACCCTTTGGTGGTGGTGCTCAGCAGCAAGCA
CCAAGTGCCTTCGGTGGTTTCGGTGGTGCAAACCAACAGAATCAAGCTCAAACCCAACCCAAGTCATTGTTCGGC
GGATTTGGGGGCACCCCGCAACAGGGAGCCGGAACAGGTTTGCTCGGCGGTGCTGGCAGCACTCCAGCTGCTGGA
TCTTCGCTCTTCGGTGGAGCCCAGCAGCAACCCCAGCAGCAGGGAGGTAGCTCACTCTTCGGTGGCCAAAATCAG
CAAGCTGGTACCGGAAGTACGCTATTTGGCGGTTCACAGAATCAACAAAAGCCCGGTGGTCTCTTCGGATCTACC
CCAGCTCCCACCACGGGTGGTTTCTCTGGCTTTGGTGCCTCGCAGCCCCAGCCAGCTGCTGGCGGTAGTAGCTTG
TTCAACACGCAGAACCAACAGCAGCAGAAGCCTGGTGGTCTCTTTTCCTCGACTACGGGAACTGGTGGTGGCGGC
ATGTTCGGCGGCGGCCAAACCAACACGGGCCAAGGCGCCGGCTCTTCGCTCTTCGGTGGTCAAAACCAGCAACCG
CAGGGTGGCCTAGGTGTCAGTGCTTTCGGTGCCTCAATGCCCGGACAACAGTCTCAGCCTGCCCCTGGTAGCTTC
CAAGCGTCGCTTCTTGATGGAAACCCGTATGGAAGTCAGTCCATCTTCTCTGGTCTTCCTGCCCCTGGTGGATCG
GCTCCCGGTCCCCTTGCCACGCCACTGTCTTCCAGCATGAAGCAAAAGCAGCGAACTCCGTTGCCGGTCTACAGA
ATTACTCCCAACGCTGCCAATCGACTCATCACCCCTCCAAAGCGTGGATATGGTTTCTCCTATTCTACCTATGGC
TCGCCATCTGGCAGCACTGGTGCCTCATCTGGTCTTGGTAGTAGTTTGTTGGGTGGTGCTGGGGGCAGTAGCAGT
CTCCGCGGCAGCGTCAATGGCAGCATTGGACGTAGCTTCAGCAAGAGTTACTCCACTAGCAACCTTCGCAAGACC
TTCGATCCAGAGGCGGACAGCATTCTTTCTCCCGGTGCCCTGCAGGCTGGCAGCGTACGTGGTAACAGCAGTCTG
AAGCGTCTCACTATCAACCGTGGTCTGAGAAATGAAATATTCTCGACCTCTCGCATTGCCCCGGCCCCTCTTCAC
ACCCCGGCCCCCCTGCTCACTAACGGAGAAGATGCCCATTCTTCCGACAAGCTGAAGAAAAAGGTCAGCTTCGAC
TCTCATACCTCCGGGGTCAATGGCGGAGAACTTGTTCACGTTGAACCTAACAGTTCCGAGCCCTCTGCTGAGGAG
CTTGGGTTCCTTCGCTCTGTGCGTAAGAGCGGTAGCCTGAATGGTTTCGATGCTGCCGGCACTTCTGATCGTCCC
GAGGCCGAATCTGCCCGCCGTGACCTTGCCGTTGTCCCCGAAAGTGCACCGCAAACCACCAACGGTGCTACTGTT
AAGCGTCTTACGTTCATCCCCGGTGGTGACCCAAGACCTGGTGAGTACTGGATGCAACCTTCCCGTGCCGAGCTT
AGCAGGATGAGCCGCGACCAGCTCAGACAAGTCGTTGACTTCACCGTTGGCCGTCAGAACTGTGGTTCTGTTACT
TTCAACGGCCCCGTTGATCTGACTACCGTTGATCTGGACAATCTTTTCTCCAATATTGTGGATATTGGTCTTCGC
AAGATTACTGTCTACCCCGAGGAATCGGTCAAGCCTGCCAGGGGCAAGGGACTGAACGTGCCATCTACCCTACGG
ATTGAGAACTCTTGGCCCCGTGGTAGAGATAAGAAGAGCAACTCGCCTGTCACTAGTGGTCCTCTGTTTGACAAA
CACATTGATCGTCTGCAGAAAGTGGGCGATACCGAGTTCGTTAACTACGAAACTGAGACTGGAACCTGGGTTTTC
AAGGTGCCTCATTTCACTACATATGGCCTTGACTACGATGAAGAGGAAGGTGAGAGTCACGACCAAAGCACCATG
AGTGCCCAAGGCCCTGACCACGCTACCAGCAGGGCTCACTTCGACCTCGCGTCTTTCGATCAGTCTACCTTTTCT
ATCGATGAGTCCTTCGTCGGTTCCATGATTGGTGTTGAAGACGATACTTTCGACTTCAAAAAGCGCAAGCTTGTT
CCTGGCTCTTTCGCTAACCAGGCCATGCCTGTGGAGGATGATTATTTTTCTGACGGTGAAACCGAGTCTTTTTTA
GAGGAAGGCTCCACGGGTTCGACTACTGAGAATGACGACGACGTCGTCACCGAGAGCCAACAGTCTGGCGATTCG
GTAGTTGGATCAGATGAGGCAGATGAAATGGATATGGCCGGTGCCTTTCCTACTCCTCATCGCACCGTGGAGCGG
AACGACTATCAGAGCACCAATGGTGACCTGGATACCACTTACCATATGTCAAGACACTTCGGCAGTCCCGCAAAG
CCTCAGCTTGATCTTAGTGGCGACTGGGCCGAGCAGCTGCAGCGTACCATCAGCCCTCGCAAGCAGAACCGTGAT
GCCTTGCGTGAAATGCAGGCAAGCGCTTTCATTGATCGTAACCTCGTGAACGATGAATCTCCCACAAACATTGCG
ACAGCATCTCCGAAGAAAGGCTTCTCAAACAGCATTGATCTTATGAACTCTTTGTTCCAGCAGCCGCGCAAGCAA
GCCGCCCCTTCTCCGCTGAAGGCTAAAGCAACGCCAAAGGGCTTTGAGTGGCCTTACAACAAGCAACCCAAGACC
TTCGCTGGCGATACAACACAAATGAGCGAATCCGATGCCGCTTTCCATGACTCTTTCAAACCCCGCTGGGGTCCC
ATGGATTCCCTCATCTGTGTCAAAAATGATATGGGGGACACAATCCTAGGGGTGAACCAGACCTGGAAAGAAAGC
TTCTCCATTTTCAGCGAAGACCGTGATATTGCAGTCATGACATACAACCAATCTAGCGAGGTCAGGGAAATGCTT
GATGTCCAGCGGCTTCAGTCCTCTATCCAGCGCATTGATGGCACCCCTTTCGTTCGTATGGCCAGGATCGACCTG
TCGCAGTTCCCTCTGTCACCATCCACCCGTTCCCAGTCGGAAGAAGAGCGCTTGGTGTGGCAGCTTCTCAACATT
CTTTTCAATGATGATATTGAGGACGATATCTCAGCGGGGGTACCGCCGCGCCTACGACAGCAATTTGCGCACCGG
ATCAGGAAGGACCGACTCACTCGTCTTTGGGAGGGAATCATTCGTGAAAAGCACTCCCAAAACCTGGATGCAATT
CGCTCCCCTGTGGAACGGGCCGTTCATTTGATCTGTTCGCACCGAGTGGAGGAAGCCTGTAAGACACTGATTGAC
AGTCAAAATCCCCATCTGGCGACTATAGTCGCACAGATTGGCCGCGATGCTACCTCGCGTGCCGACATAGCGAAC
CAAATCGATGTGTGGCGTCAGAACAACATACTCTCGGAGATGACTGAACCCATACGAGCCCTTTACGAACTGGTC
GCTGGGAATGCTCTCCGCAGCGAAGGCAAATCGGGCGGTGCGCTTGAAGACCGGGCCTCCAGCTTTGGCTTCACC
GAGCGGTTCGACCTAGATTGGTTCCAGGCCTTTGGTCTTCGTCTGTGGTATTGCACGGCTGAAGATGAGCCAATC
GAGGTAGCTGTCTCCAAGTTCCTTGCGGACTTGGCCACCGGACAAGAACCCGCCTTCCCCCACCCATCGCACCAG
GCTAGTACCCGTGCAGTCCCGCAGCCTGGCTCTGACACCCTTGGGCGCGAATCTCCTCTTTGGGTTCTGCTCAAG
GCCTTCTCGGCGATTCAAGGCCACGTCACCCAACCCGTTGAATTCCCCGCATCTTTCCTTCCCGAATCCGTCTCC
GGTGACCGTCTCTCCAACCGACTGTCCTTCCAGCTACACCACGTTCTCGCTGCGGTAGTCGGAAAAAACCAGGCC
ATCAAAATCAACCAGCACCAAACTGACCAACTCGTCCGGGATTTTGCTTCTGAACTCAGTGCAGGCGGAAAGCTT
GATCAAGCATTGTTTGTCCTCCTGCACCTCTCCCAAGGTAACGACCGAAAGGGCGCTGTCCAAGAAACTCTCGCC
CGCTTCGCCGCTCAACTCCCCGAGCCCTTCGCTGCCGACGGCTCCTCCGACCTGGCATGGCAATATCTCATCACT
GATCTCCAGCTTCCCGAAGCCTGGATCTGGGTTGCCAAGGCTCTGTATGCTCGCGACATCGGCGATTCTGCCCGT
GAGGTAGACTGTCTTATTCGCGGCAAGCACTGGAACGATGCCCACACCACCTTTTGTCGCATCGTCGGCCCAAGC
ACCATCATCGAGGGCGACTACCGTACCCTCGAAACTCTGGTCTCCGGCTTCGGTGACGCGCCTGAGCGTAAAATG
CGCGGCTGGTCTTCTGGCGGCGGCGTTTATGAAGATTTCCTCCGCCTTGTCAACTCCACCAGCGGCCGACGTGAT
CCAATTCGCCTGAACCGCCTAGTGAACGCTCTTGTTGCGATGGGCGATCGTGTCCAGGGATCCAGTCTGGAAGGA
CTGGAGGAGCGTGTTGCATTCAAGGAGATGAGCCGGGCTGTCGCCGGCTGGATTACACACGAAGATGTTCATTCC
GTTGAATCTTCCGCTGTCCTGGGCCTGCCCTTGACAGGTGACGCTCGCGTTTTGCAGACCGCAGAGATGAGCCGT
CGATACTACGGCGTCATCATGGCTGGTGGTTATTAA
Gene >Pro_DTO377G3_2|g3748.t1
ATGTCTTTCGGATTTGGAGGGTTCGGTTCGAACAACCAAAGCAGCGGCTTTGGTACTGGCACTGGCTTCGGAGCT
GGCACCAGCACTGGTGGAGGTAGGTCTTTTCTGTCCCCCTTTTCGAATTCCCCTTGTACATTGGGGCCATATCCC
CATGTTTCCCATTCTACTCGTGTCCTCGGCTTTCCCTATCAACAATCGATGCTCCTAATTCCGACCCGCGATGGT
GCCACGCGCAAGACAAAAAACTTCAACATAATAAGCTTCGCCGTGCAATTGAAATTCACCAGCGGACCATTTGGA
TGCATTAGCGACACCACAACAAGATAAGGAATGCAAGAGCTTCTTCGAATCCAAGTCTCTCTGACCGCGATCCCC
TCCGTCATCTAGGCTTTGGCTCGACAGCTTCCCCGTTCGGAGGTGCTACTACTGGCACTTCAAGCGCCTTCGGTA
GCACCCCTAGCACATCTACTGGCTTCGGCACTGGCGGAGGTACGTGCTCAATCGTGAGCTTTGCGCTGCCCTCCC
GATTTTCCCTGGCGAGGTCTCCCGTCGCATCACGTGGCCTTGCGATCCAAACGACCGCTCGCGCACATGGGATCT
GTGAATGTGCTCCTCGGTCCCCCTGGAATGACCGCTCGTGGCTCCCCCCTGGAATCTCCACACCTGCGACTTGCC
CACATTTCCACCGACATGCGCCCCAGGACCACTCTTCATCAATCTGCACTTGTTTAGTCGCTTCATTGAAACGTC
GATCGTGTTTGCTAACTCTTGATTTTCATTAGGATTCGGAACCAATACTACACCCCAACAACCTAATGCCCTTTT
CGGCGGCCAAACTCGCCCCGGTGGATTCGGCACCCCCAACACTCCTAACACCGGGTCTCTCTTCGGAGGAGGCAC
TCAGACTGCTGGTACCACCGGCGGCTTCGGTGCTGGTGGAGGATTCGGTTCTACCGGTACCACTGGCGGCTTTGG
CGCCAATGCCAGCGCAACCCCTGCGGGTGGAAGCCTTTTCGGTGGTGCCAAACCTACGGGCTTTGGCACTGCTAC
CGGTACCAGCGCATTCGGCACTAGCGGTGGCTTCGGATCTACCGCTGCCCCCACCACAACCCCCAGCACAGGTTT
CGGCGGCTCAGGTACTGCTTTCCAAGGAGGTCTACCTAACTGCGAAGGTACTGGCAGCACCCCGTTCAGTCCCTG
GAACGAGAAGGATACCAGCTCAGCCAACACCACGAACCACTACCAAAGCATCTGTTTTATGCAACCCTACAGTAA
ATGGTCTTTCGAGGAACTGCGCCTAGCGGATTACCAACAAGGTCGTCGTTTCGGCAACGGCAGTGGCCAAGCCGG
TGGTTTTGGCGCTCCTGCTTTCGGTAACACTACAACCGGTGGATTTGGTCAACAAAATACAACAGCTACTCCTGC
CTTTGGCGCTAGCACCACTCCGTTCGGAGGGGCTGCCACAAGTGCGCCAACCGGCTTCGGTGCAACCCAGACTGC
CGGTGGATTCGGCTCCACTGGTGCTAATCCCTTGTTCGGTTCAGCAGCCAAACCAGCAACTTCCTTATTCGGTGG
AACTACTCCTGCAGCTTCATCAGGAAGCCTCTTTGGGGGAGCCACACAGACCGCTGGTGGCTTCGGAGGCAACAC
CGGTACTGGATCGGCTTTCGGCAACACCGGCGGGTCTTTGTTCGGTAGTAACAACCAGCAACAGCAGAACAAGCC
CGCCTTTGGCGCCACTGGTACAACTGGTGGCGCCTTCGGTGGTTTCGGTAATACCCAAACAACCACTGCCGCGAA
TCCGTTCGGAGCTCCGACCGCCACAGCCTCACCCTTTGGTGGTGGTGCTCAGCAGCAAGCACCAAGTGCCTTCGG
TGGTTTCGGTGGTGCAAACCAACAGAATCAAGCTCAAACCCAACCCAAGTCATTGTTCGGCGGATTTGGGGGCAC
CCCGCAACAGGGAGCCGGAACAGGTTTGCTCGGCGGTGCTGGCAGCACTCCAGCTGCTGGATCTTCGCTCTTCGG
TGGAGCCCAGCAGCAACCCCAGCAGCAGGGAGGTAGCTCACTCTTCGGTGGCCAAAATCAGCAAGCTGGTACCGG
AAGTACGCTATTTGGCGGTTCACAGAATCAACAAAAGCCCGGTGGTCTCTTCGGATCTACCCCAGCTCCCACCAC
GGGTGGTTTCTCTGGCTTTGGTGCCTCGCAGCCCCAGCCAGCTGCTGGCGGTAGTAGCTTGTTCAACACGCAGAA
CCAACAGCAGCAGAAGCCTGGTGGTCTCTTTTCCTCGACTACGGGAACTGGTGGTGGCGGCATGTTCGGCGGCGG
CCAAACCAACACGGGCCAAGGCGCCGGCTCTTCGCTCTTCGGTGGTCAAAACCAGCAACCGCAGGGTGGCCTAGG
TGTCAGTGCTTTCGGTGCCTCAATGCCCGGACAACAGTCTCAGCCTGCCCCTGGTAGCTTCCAAGCGTCGCTTCT
TGATGGAAACCCGTATGGAAGTCAGTCCATCTTCTCTGGTCTTCCTGCCCCTGGTGGATCGGCTCCCGGTCCCCT
TGCCACGCCACTGTCTTCCAGCATGAAGCAAAAGCAGCGAACTCCGTTGCCGGTCTACAGAATTACTCCCAACGC
TGCCAATCGACTCATCACCCCTCCAAAGCGTGGATATGGTTTCTCCTATTCTACCTATGGCTCGCCATCTGGCAG
CACTGGTGCCTCATCTGGTCTTGGTAGTAGTTTGTTGGGTGGTGCTGGGGGCAGTAGCAGTCTCCGCGGCAGCGT
CAATGGCAGCATTGGACGTAGCTTCAGCAAGAGTTACTCCACTAGCAACCTTCGCAAGACCTTCGATCCAGAGGC
GGACAGCATTCTTTCTCCCGGTGCCCTGCAGGCTGGCAGCGTACGTGGTAACAGCAGTCTGAAGCGTCTCACTAT
CAACCGTGGTCTGAGAAATGAAATATTCTCGACCTCTCGCATTGCCCCGGCCCCTCTTCACACCCCGGCCCCCCT
GCTCACTAACGGAGAAGATGCCCATTCTTCCGACAAGCTGAAGAAAAAGGTCAGCTTCGACTCTCATACCTCCGG
GGTCAATGGCGGAGAACTTGTTCACGTTGAACCTAACAGTTCCGAGCCCTCTGCTGAGGAGCTTGGGTTCCTTCG
CTCTGTGCGTAAGAGCGGTAGCCTGAATGGTTTCGATGCTGCCGGCACTTCTGATCGTCCCGAGGCCGAATCTGC
CCGCCGTGACCTTGCCGTTGTCCCCGAAAGTGCACCGCAAACCACCAACGGTGCTACTGTTAAGCGTCTTACGTT
CATCCCCGGTGGTGACCCAAGACCTGGTGAGTACTGGATGCAACCTTCCCGTGCCGAGCTTAGCAGGATGAGCCG
CGACCAGCTCAGACAAGTCGTTGACTTCACCGTTGGCCGTCAGAACTGTGGTTCTGTTACTTTCAACGGCCCCGT
TGATCTGACTACCGTTGATCTGGACAATCTTTTCTCCAATATTGTGGATATTGGTCTTCGCAAGATTACTGTCTA
CCCCGAGGAATCGGTCAAGCCTGCCAGGGGCAAGGGACTGAACGTGCCATCTACCCTACGGATTGAGAACTCTTG
GCCCCGTGGTAGAGATAAGAAGAGCAACTCGCCTGTCACTAGTGGTCCTCTGTTTGACAAACACATTGATCGTCT
GCAGAAAGTGGGCGATACCGAGTTCGTTAACTACGAAACTGAGACTGGAACCTGGGTTTTCAAGGTGCCTCATTT
CACTACATATGGCCTTGACTACGATGAAGAGGAAGGTGAGAGTCACGACCAAAGCACCATGAGTGCCCAAGGCCC
TGACCACGCTACCAGCAGGGCTCACTTCGACCTCGCGTCTTTCGATCAGTCTACCTTTTCTATCGATGAGTCCTT
CGTCGGTTCCATGATTGGTGTTGAAGACGATACTTTCGACTTCAAAAAGCGCAAGCTTGTTCCTGGCTCTTTCGC
TAACCAGGCCATGCCTGTGGAGGATGATTATTTTTCTGACGGTGAAACCGAGTCTTTTTTAGAGGAAGGCTCCAC
GGGTTCGACTACTGAGAATGACGACGACGTCGTCACCGAGAGCCAACAGTCTGGCGATTCGGTAGTTGGATCAGA
TGAGGCAGATGAAATGGATATGGCCGGTGCCTTTCCTACTCCTCATCGCACCGTGGAGCGGAACGACTATCAGAG
CACCAATGGTGACCTGGATACCACTTACCATATGTCAAGACACTTCGGCAGTCCCGCAAAGCCTCAGCTTGATCT
TAGTGGCGACTGGGCCGAGCAGCTGCAGCGTACCATCAGCCCTCGCAAGCAGAACCGTGATGCCTTGCGTGAAAT
GCAGGCAAGCGCTTTCATTGATCGTAACCTCGTGAACGATGAATCTCCCACAAACATTGCGACAGCATCTCCGAA
GAAAGGCTTCTCAAACAGCATTGATCTTATGAACTCTTTGTTCCAGCAGCCGCGCAAGCAAGCCGCCCCTTCTCC
GCTGAAGGCTAAAGCAACGCCAAAGGGCTTTGAGGTTAGAACTCCCTTCTTATGTTCACACTGATTATAATTCCC
TTTCTTTTTTTCCTTTTCTCACTGCATCATGTATCTATGAAATTGCGCGTCACTTTTCAGATAGTTTAACAAATG
TGATAACCTGAGCTAAAACCATTTTTCTTCCTCTAGTGGCCTTACAACAAGCAACCCAAGACCTTCGCTGGCGAT
ACAACACAAATGAGCGAATCCGATGCCGCTTTCCATGACTCTTTCAAACCCCGCTGGGGTCCCATGGATTCCCTC
ATCTGTGTCAAAAATGATATGGGGGACACAATCCTAGGGGTGAACCAGACCTGGAAAGAAAGCTTCTCCATTTTC
AGCGAAGACCGTGATATTGCAGTCATGACATACAACCAATCTAGCGAGGTAGGTTTAGTGGCTTTATTGGTTTAT
TGAACTGGATACTAATGATGATACAGGTCAGGGAAATGCTTGATGTCCAGCGGCTTCAGTCCTCTATCCAGCGCA
TTGATGGCACCCCTTTCGTTCGTATGGCCAGGATCGACCTGTCGCAGTTCCCTCTGTCACCATCCACCCGTTCCC
AGTCGGAAGAAGAGCGCTTGGTGTGGCAGCTTCTCAACATTCTTTTCAATGATGATATTGAGGACGATATCTCAG
CGGGGGTACCGCCGCGCCTACGACAGCAATTTGCGCACCGGATCAGGAAGGACCGACTCACTCGTCTTTGGGAGG
GAATCATTCGTGAAAAGCACTCCCAAAACCTGGATGCAATTCGCTCCCCTGTGGAACGGGCCGTTCATTTGATCT
GTTCGCACCGAGTGGAGGAAGCCTGTAAGACACTGATTGACAGTCAAAATCCCCATCTGGCGACTATAGTCGCAC
AGATTGGCCGCGATGCTACCTCGCGTGCCGACATAGCGAACCAAATCGATGTGTGGCGTCAGAACAACATACTCT
CGGAGATGACTGAACCCATACGAGCCCTTTACGAACTGGTCGCTGGGAATGCTCTCCGCAGCGAAGGCAAATCGG
GCGGTGCGCTTGAAGACCGGGCCTCCAGCTTTGGCTTCACCGAGCGGTTCGACCTAGATTGGTTCCAGGCCTTTG
GTCTTCGTCTGTGGTATTGCACGGCTGAAGATGAGCCAATCGAGGTAGCTGTCTCCAAGTTCCTTGCGGACTTGG
CCACCGGACAAGAACCCGCCTTCCCCCACCCATCGCACCAGGCTAGTACCCGTGCAGTCCCGCAGCCTGGCTCTG
ACACCCTTGGGCGCGAATCTCCTCTTTGGGTTCTGCTCAAGGCCTTCTCGGCGATTCAAGGCCACGTCACCCAAC
CCGTTGAATTCCCCGCATCTTTCCTTCCCGAATCCGTCTCCGGTGACCGTCTCTCCAACCGACTGTCCTTCCAGC
TACACCACGTTCTCGCTGCGGTAGTCGGAAAAAACCAGGCCATCAAAATCAACCAGCACCAAACTGACCAACTCG
TCCGGGATTTTGCTTCTGAACTCAGTGCAGGCGGAAAGCTTGATCAAGCATTGTTTGTCCTCCTGCACCTCTCCC
AAGGTAACGACCGAAAGGGCGCTGTCCAAGAAACTCTCGCCCGCTTCGCCGCTCAACTCCCCGAGCCCTTCGCTG
CCGACGGCTCCTCCGACCTGGCATGGCAATATCTCATCACTGATCTCCAGCTTCCCGAAGCCTGGATCTGGGTTG
CCAAGGCTCTGTATGCTCGCGACATCGGCGATTCTGCCCGTGAGGTAGACTGTCTTATTCGCGGCAAGCACTGGA
ACGATGCCCACACCACCTTTTGTCGCATCGTCGGCCCAAGCACCATCATCGAGGGCGACTACCGTACCCTCGAAA
CTCTGGTCTCCGGCTTCGGTGACGCGCCTGAGCGTAAAATGCGCGGCTGGTCTTCTGGCGGCGGCGTTTATGAAG
ATTTCCTCCGCCTTGTCAACTCCACCAGCGGCCGACGTGATCCAATTCGCCTGAACCGCCTAGTGAACGCTCTTG
TTGCGATGGGCGATCGTGTCCAGGGATCCAGTCTGGAAGGACTGGAGGAGCGTGTTGCATTCAAGGAGATGAGCC
GGGCTGTCGCCGGCTGGATTACACACGAAGATGTTCATGTTAGTTCCCTCCCTCCTTTCCGCTGATATATTGCTT
TCGTTCATTACTGACTTCCGTCTTTTTACAGTCCGTTGAATCTTCCGCTGTCCTGGGCCTGCCCTTGACAGGTGA
CGCTCGCGTTTTGCAGACCGCAGAGATGAGCCGTCGATACTACGGCGTCATCATGGCTGGTGGTTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail