Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3742.t1
Gene name
Locationscaffold_06:617693..619121
Strand-
Gene length (bp)1428
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.3E-39 51 435

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 84 106 22
3 127 149 22
4 159 181 22
5 188 210 22
6 230 252 22
7 265 287 22
8 307 327 20
9 348 370 22
10 380 402 22
11 414 436 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3742.t1
MEVNTAPPVYENDKIAERKDELTYEEEGPIKTGEVHDAFGNEEYADIKYKTLKWWQCGLLMICESVSLGVLSLPA
AMATLGLVPGIILIIGLGLLATYTGYNIGLFRERYPHIQNLGDAGEILLGRFGRELFGTGQFLFCIFVMGSHILT
FRVMLNTLTNHGTCSVVFSVVGMVISILLSMPRTMKGMTWISFLSFLSILSAVMITMISVGVEKHPGRVIHATVP
NDLYTAFQAVSNIVFAYCAHVAFFGLIAEMETPQDFKKSLFMLQGFEICLYLTAAIVIYFYIGTDVHSPALTSAG
PLMSKIAYGIAIPTIVGAGVVNGHIGLKYIYFRLCSKSGLMHQNNKRAVGLWIGLGIACWVVAWIISEAIPVFSD
LNSLISALFASWFSYGLSGIYWLHLNYGQWFSSPRKIALTVLNIFIACIGLVLCVLGLYASGTAINKNSNSNSFT
CADTDT*
Coding >Pro_DTO377G3_2|g3742.t1
ATGGAGGTCAACACAGCACCACCCGTCTATGAGAATGACAAGATCGCAGAACGGAAAGATGAATTAACATACGAG
GAGGAGGGCCCCATCAAGACTGGCGAAGTCCACGATGCCTTTGGCAACGAGGAGTACGCTGACATCAAGTATAAG
ACCTTGAAGTGGTGGCAATGTGGCTTGCTCATGATCTGTGAGTCAGTCTCACTGGGTGTGTTGTCGCTGCCAGCA
GCCATGGCTACCCTGGGTCTCGTCCCCGGTATCATTCTGATTATCGGCCTCGGACTTCTCGCAACATACACTGGC
TACAATATTGGCCTCTTCCGTGAACGGTATCCTCATATCCAGAACCTGGGTGATGCGGGTGAGATTTTGCTAGGC
CGCTTCGGCCGAGAGCTCTTTGGTACTGGCCAGTTCCTCTTCTGTATCTTCGTCATGGGCAGTCACATCCTTACC
TTCCGTGTCATGCTGAACACCCTCACCAACCACGGCACCTGCTCCGTTGTGTTCAGTGTCGTCGGCATGGTTATC
TCAATTCTCCTGTCCATGCCCCGTACGATGAAGGGTATGACCTGGATATCGTTCCTATCATTCCTCAGCATCTTG
AGCGCCGTGATGATCACTATGATTTCCGTGGGTGTCGAGAAGCACCCCGGTCGTGTCATCCACGCCACAGTCCCC
AACGACCTGTACACTGCTTTCCAGGCCGTTTCCAACATCGTCTTCGCTTACTGCGCCCACGTTGCTTTCTTCGGT
TTGATCGCCGAAATGGAGACGCCCCAGGATTTCAAGAAGTCCTTGTTCATGCTTCAGGGCTTTGAGATCTGTCTC
TACCTGACCGCTGCTATTGTGATCTATTTCTACATTGGCACAGACGTGCATTCCCCTGCCCTCACTTCCGCAGGA
CCCCTGATGAGCAAGATTGCCTACGGCATTGCTATCCCCACCATTGTCGGCGCCGGTGTCGTCAACGGCCACATC
GGCTTGAAGTACATCTACTTCCGCCTCTGCTCCAAGTCCGGTCTGATGCACCAGAACAACAAGCGTGCCGTCGGT
CTCTGGATCGGTCTTGGTATTGCTTGCTGGGTCGTTGCGTGGATCATCTCCGAAGCCATTCCTGTCTTCAGCGAC
CTGAACAGTTTGATCAGTGCTCTGTTCGCTTCATGGTTCAGTTACGGTCTGTCCGGTATTTACTGGCTTCACCTC
AACTATGGTCAATGGTTCTCCTCTCCCCGCAAGATCGCCCTTACCGTCCTCAACATCTTCATTGCCTGCATTGGT
TTGGTGCTGTGCGTTCTTGGCCTGTATGCTTCTGGTACGGCTATCAACAAGAACTCCAACAGCAACAGCTTCACC
TGTGCCGACACGGATACTTAG
Transcript >Pro_DTO377G3_2|g3742.t1
ATGGAGGTCAACACAGCACCACCCGTCTATGAGAATGACAAGATCGCAGAACGGAAAGATGAATTAACATACGAG
GAGGAGGGCCCCATCAAGACTGGCGAAGTCCACGATGCCTTTGGCAACGAGGAGTACGCTGACATCAAGTATAAG
ACCTTGAAGTGGTGGCAATGTGGCTTGCTCATGATCTGTGAGTCAGTCTCACTGGGTGTGTTGTCGCTGCCAGCA
GCCATGGCTACCCTGGGTCTCGTCCCCGGTATCATTCTGATTATCGGCCTCGGACTTCTCGCAACATACACTGGC
TACAATATTGGCCTCTTCCGTGAACGGTATCCTCATATCCAGAACCTGGGTGATGCGGGTGAGATTTTGCTAGGC
CGCTTCGGCCGAGAGCTCTTTGGTACTGGCCAGTTCCTCTTCTGTATCTTCGTCATGGGCAGTCACATCCTTACC
TTCCGTGTCATGCTGAACACCCTCACCAACCACGGCACCTGCTCCGTTGTGTTCAGTGTCGTCGGCATGGTTATC
TCAATTCTCCTGTCCATGCCCCGTACGATGAAGGGTATGACCTGGATATCGTTCCTATCATTCCTCAGCATCTTG
AGCGCCGTGATGATCACTATGATTTCCGTGGGTGTCGAGAAGCACCCCGGTCGTGTCATCCACGCCACAGTCCCC
AACGACCTGTACACTGCTTTCCAGGCCGTTTCCAACATCGTCTTCGCTTACTGCGCCCACGTTGCTTTCTTCGGT
TTGATCGCCGAAATGGAGACGCCCCAGGATTTCAAGAAGTCCTTGTTCATGCTTCAGGGCTTTGAGATCTGTCTC
TACCTGACCGCTGCTATTGTGATCTATTTCTACATTGGCACAGACGTGCATTCCCCTGCCCTCACTTCCGCAGGA
CCCCTGATGAGCAAGATTGCCTACGGCATTGCTATCCCCACCATTGTCGGCGCCGGTGTCGTCAACGGCCACATC
GGCTTGAAGTACATCTACTTCCGCCTCTGCTCCAAGTCCGGTCTGATGCACCAGAACAACAAGCGTGCCGTCGGT
CTCTGGATCGGTCTTGGTATTGCTTGCTGGGTCGTTGCGTGGATCATCTCCGAAGCCATTCCTGTCTTCAGCGAC
CTGAACAGTTTGATCAGTGCTCTGTTCGCTTCATGGTTCAGTTACGGTCTGTCCGGTATTTACTGGCTTCACCTC
AACTATGGTCAATGGTTCTCCTCTCCCCGCAAGATCGCCCTTACCGTCCTCAACATCTTCATTGCCTGCATTGGT
TTGGTGCTGTGCGTTCTTGGCCTGTATGCTTCTGGTACGGCTATCAACAAGAACTCCAACAGCAACAGCTTCACC
TGTGCCGACACGGATACTTAG
Gene >Pro_DTO377G3_2|g3742.t1
ATGGAGGTCAACACAGCACCACCCGTCTATGAGAATGACAAGATCGCAGAACGGAAAGATGAATTAACATACGAG
GAGGAGGGCCCCATCAAGACTGGCGAAGTCCACGATGCCTTTGGCAACGAGGAGTACGCTGACATCAAGTATAAG
ACCTTGAAGTGGTGGTATGTACTATCGTTGGGAAAAGAGCCTCTCGATTGACCGTGCTAACACGTCTTCAGGCAA
TGTGGCTTGCTCATGATCTGTGAGTCAGTCTCACTGGGTGTGTTGTCGCTGCCAGCAGCCATGGCTACCCTGGGT
CTCGTCCCCGGTATCATTCTGATTATCGGCCTCGGACTTCTCGCAACATACACTGGCTACAATATTGGCCTCTTC
CGTGAACGGTATCCTCATATCCAGAACCTGGGTGATGCGGGTGAGATTTTGCTAGGCCGCTTCGGCCGAGAGCTC
TTTGGTACTGGCCAGTTCCTCTTCTGTATCTTCGTCATGGGCAGTCACATCCTTACCTTCCGTGTCATGCTGAAC
ACCCTCACCAACCACGGCACCTGCTCCGTTGTGTTCAGTGTCGTCGGCATGGTTATCTCAATTCTCCTGTCCATG
CCCCGTACGATGAAGGGTATGACCTGGATATCGTTCCTATCATTCCTCAGCATCTTGAGCGCCGTGATGATCACT
ATGATTTCCGTGGGTGTCGAGAAGCACCCCGGTCGTGTCATCCACGCCACAGTCCCCAACGACCTGTACACTGCT
TTCCAGGCCGTTTCCAACATCGTCTTCGCTTACTGCGCCCACGTTGCTTTCTTCGGTTTGATCGCCGAAATGGAG
ACGCCCCAGGATTTCAAGAAGTCCTTGTTCATGCTTCAGGGCTTTGAGATCTGTCTCTACCTGACCGCTGCTATT
GTGATCTATTTCTACATTGGCACAGACGTGCATTCCCCTGCCCTCACTTCCGCAGGACCCCTGATGAGCAAGATT
GCCTACGGCATTGCTATCCCCACCATTGTCGGCGCCGGTGTCGTCAACGGCCACATCGGCTTGAAGTACATCTAC
TTCCGCCTCTGCTCCAAGTCCGGTCTGATGCACCAGAACAACAAGCGTGCCGTCGGTCTCTGGATCGGTCTTGGT
ATTGCTTGCTGGGTCGTTGCGTGGATCATCTCCGAAGCCATTCCTGTCTTCAGCGACCTGAACAGTTTGATCAGT
GCTCTGTTCGCTTCATGGTTCAGTTACGGTCTGTCCGGTATTTACTGGCTTCACCTCAACTATGGTCAATGGTTC
TCCTCTCCCCGCAAGATCGCCCTTACCGTCCTCAACATCTTCATTGCCTGCATTGGTTTGGTGCTGTGCGTTCTT
GGCCTGTATGCTTCTGGTACGGCTATCAACAAGAACTCCAACAGCAACAGCTTCACCTGTGCCGACACGGATACT
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail