Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g374.t1
Gene name
Locationscaffold_01:949800..953294
Strand-
Gene length (bp)3494
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18136 DNApol_Exo DNA mitochondrial polymerase exonuclease domain 1.3E-106 117 395
PF00476 DNA_pol_A DNA polymerase family A 2.3E-40 597 947

GO

GO Term Description Terminal node
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0003677 DNA binding Yes
GO:0006260 DNA replication Yes
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006259 DNA metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0016779 nucleotidyltransferase activity No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0034061 DNA polymerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 28.43 17.27 39.60
5d_25C Five days - 25 degrees Celsius 28.36 17.22 39.51
7d_25C Seven days - 25 degrees Celsius 31.42 19.26 43.58
10d_25C Ten days - 25 degrees Celsius 33.33 20.44 46.23
7d_15C Seven days - 15 degrees Celsius 30.93 18.72 43.15
7d_30C Seven days - 30 degrees Celsius 23.59 14.22 32.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.994324 no
3d_25C 7d_25C 0.729846 no
3d_25C 7d_15C 0.781792 no
3d_25C 7d_30C 0.463254 no
3d_25C 10d_25C 0.540856 no
5d_25C 7d_25C 0.720723 no
5d_25C 7d_15C 0.775130 no
5d_25C 7d_30C 0.468993 no
5d_25C 10d_25C 0.528261 no
7d_25C 7d_15C 0.964956 no
7d_25C 7d_30C 0.195514 no
7d_25C 10d_25C 0.847177 no
7d_15C 7d_30C 0.232755 no
7d_15C 10d_25C 0.800650 no
7d_30C 10d_25C 0.106607 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g374.t1
MLSWKFSCTPCSKGAVESFLRRSSPFLVKPPSCYQSDRSHTRLFSTSADNVTTRRSLSVPSSSRFNDIGVQQLSD
HVHAQVFPNKGRVPDPELVALSKDHLARHELLGKSQNGAGPIAFDLPALKGQTLDEHFYKLGMDSSEPYLSWAKS
YAALTCPAKPRKWVQRSGWTKYHTDGTSEPVDAPNESMLTFDTEVMYKDNPFAVMACAVSPTAWYAWISPWLLGE
SENQVQLIPLGDPTQSRIVVGHNIGYDRARVLEEYNMQQSQNFFLDTMSLHVAVNGMCSQQRPTWMRHKKNQDMR
DKIANDHDSVELAALLENNMLREEEEELWVGRSSVNSLRDVAKFHCDVTIDKAQRDLFGELDRDSIVARLEELLD
YCAADVAITHRVYRKVFPNFLETCPHPVSFGALRHLSSVILPVNESWEEYLTSAEETYHKRLDDVQSKLLALCDE
ALKYKDQPDIYTIDPWLQQLDWSGQEIKMAKGKKKGDPPRPAARQKKPGMPKWYKDLFTSNAADINLTVRTRIAP
ILLKLSWDNYPLVWSDLHGWTFRVPRDQIKQYENQPVVMCDMTEEKNTELRDDRKAIYFKIPHKDGPQARCTNPL
GKGYMQYFERGILSSQYELAKQALDMNASCSYWISARDRIKGQIVVYEDQAQKGREKSEAGDNRIGFILPQVIPM
GTITRRAVENTWLTASNAKANRVGSELKAMIKAPPGYSFVGADVDSQELWIASLVGDAPFQIHGGNAIGFMCLEG
SKAEGTDLHSRSASILGISRNDAKVFNYGRIYGAGVKFAATLLRQFNPSLTEKQTQETAKNLYKETKGTRTSRRL
LSETPFWRGGTESFVFNKLEEFADQERPRTPALGAGITEALMRRFINKGSFMTSRINWAIQSSGVDYLHLLIVSM
DYLIRRFNIQARLAITVHDEIRYLVKDEDRYRAAMALQIANVWTRALFSQQVGIDDLPQSCAYFSAVDIDHVLRK
EVDMDCVTPSHPHKIPHGETLDITQLLDKDQEAFLDPSITPQSPPNPDKYPYTPRESVMSAFQASNDIDFIKAQI
TKDDKELRDIIKEKTRAAASVIAPTPRTPSTKPKGTSTNWSSAKPQRAVLMDMESGLYPDFHGSRPSFHGNKQPQ
IGLHRPPWKPRAIARV*
Coding >Pro_DTO377G3_2|g374.t1
ATGTTATCTTGGAAGTTCTCCTGCACTCCTTGTTCCAAGGGTGCCGTGGAATCTTTCTTGCGACGAAGCTCGCCG
TTCCTGGTTAAGCCGCCATCGTGCTACCAGTCAGACAGAAGTCATACAAGATTATTCTCTACTTCCGCCGACAAT
GTGACCACAAGACGATCTCTTTCTGTCCCTTCCTCATCCAGATTCAATGACATCGGAGTCCAACAGCTCAGCGAC
CATGTCCATGCTCAAGTTTTCCCCAACAAAGGTCGCGTTCCGGACCCAGAACTAGTCGCTCTCTCGAAGGATCAT
TTAGCTCGACATGAGCTCCTGGGCAAATCTCAAAATGGCGCCGGTCCTATCGCATTCGATCTTCCTGCTCTCAAG
GGACAAACGTTGGACGAACACTTCTACAAACTTGGAATGGATTCTTCCGAACCATACCTGTCATGGGCTAAGTCA
TATGCGGCTCTTACCTGTCCGGCCAAACCACGCAAATGGGTCCAACGCAGCGGATGGACGAAATACCACACTGAC
GGAACCTCTGAACCTGTCGACGCCCCAAATGAATCAATGTTAACATTCGACACCGAGGTCATGTACAAAGATAAT
CCATTTGCGGTCATGGCTTGCGCGGTAAGCCCGACAGCTTGGTATGCATGGATATCACCGTGGCTGCTTGGCGAG
TCAGAGAATCAAGTACAGCTGATACCCTTGGGAGACCCCACTCAATCTCGCATTGTGGTTGGCCACAATATTGGT
TACGACCGAGCCCGAGTCCTTGAGGAATACAACATGCAGCAGTCTCAAAACTTCTTTCTCGACACAATGTCCCTA
CATGTGGCGGTCAACGGCATGTGTTCGCAACAGAGACCGACTTGGATGCGCCACAAAAAGAATCAGGACATGAGA
GATAAAATCGCGAATGACCACGATTCTGTGGAGCTTGCCGCACTTCTCGAAAACAACATGTTGAGAGAAGAAGAG
GAGGAGCTTTGGGTTGGGCGAAGCTCGGTGAACTCCCTGCGTGATGTGGCCAAATTCCATTGTGATGTCACTATC
GATAAGGCGCAGAGAGATCTGTTCGGTGAACTTGATCGTGACTCTATTGTGGCCAGACTGGAGGAACTTCTCGAC
TATTGTGCTGCCGATGTTGCCATCACCCACCGTGTCTACCGAAAAGTTTTCCCCAATTTTCTCGAGACTTGCCCG
CATCCCGTCAGTTTCGGTGCTCTTCGACACTTATCCTCCGTCATTTTACCAGTCAATGAGTCATGGGAAGAGTAT
CTTACCAGCGCAGAGGAAACATATCATAAGCGGCTGGACGATGTCCAGAGTAAACTACTAGCACTATGCGACGAA
GCATTGAAGTATAAAGACCAACCAGACATTTACACGATTGATCCTTGGCTACAACAGCTGGACTGGTCCGGCCAG
GAGATCAAAATGGCCAAAGGAAAGAAGAAGGGTGATCCACCTCGGCCGGCAGCGAGGCAAAAGAAACCAGGAATG
CCCAAGTGGTACAAGGATCTTTTTACCTCCAACGCCGCCGATATTAACTTGACGGTGCGGACTCGCATTGCGCCA
ATTCTGCTCAAACTTTCCTGGGACAACTATCCTCTTGTTTGGTCGGACCTGCACGGATGGACTTTCCGCGTTCCT
CGTGATCAAATCAAACAGTATGAGAATCAGCCAGTCGTCATGTGCGATATGACCGAGGAAAAGAACACCGAGTTG
CGAGACGATAGAAAAGCCATATACTTCAAAATCCCCCACAAGGACGGCCCACAAGCTAGGTGTACCAATCCGCTT
GGAAAAGGGTATATGCAGTATTTCGAACGTGGGATCCTGTCATCTCAGTATGAACTTGCCAAACAAGCGCTGGAT
ATGAATGCGTCATGTTCTTATTGGATCAGCGCCCGGGATCGAATCAAGGGTCAAATCGTGGTCTATGAAGATCAG
GCGCAAAAAGGCAGAGAGAAAAGTGAAGCCGGCGATAATCGTATCGGATTTATTCTGCCTCAAGTCATTCCAATG
GGGACCATCACTCGACGCGCCGTGGAAAATACTTGGTTGACTGCAAGTAATGCGAAGGCCAACCGTGTTGGGTCA
GAGCTAAAAGCTATGATCAAAGCACCGCCGGGCTACTCGTTCGTTGGAGCCGATGTCGACTCCCAGGAATTATGG
ATTGCAAGTCTTGTCGGAGATGCCCCATTCCAGATTCACGGAGGAAACGCAATCGGCTTCATGTGCTTAGAAGGG
TCTAAAGCTGAGGGGACGGATCTTCACTCACGAAGTGCGTCGATTCTGGGAATCTCGCGGAATGACGCCAAGGTC
TTCAACTACGGCCGAATCTACGGGGCAGGCGTCAAGTTCGCCGCTACTTTACTTCGCCAGTTCAATCCGTCTCTA
ACTGAAAAGCAGACACAAGAGACTGCCAAGAACCTGTACAAAGAGACTAAGGGAACGCGCACTTCACGTCGCCTC
TTGAGTGAGACGCCGTTTTGGCGAGGTGGCACTGAATCCTTTGTGTTCAATAAACTCGAAGAGTTTGCGGATCAG
GAACGACCTAGAACCCCTGCTTTGGGTGCTGGGATCACTGAGGCGCTCATGCGACGTTTCATTAATAAAGGCAGC
TTCATGACATCCCGAATCAATTGGGCTATTCAGTCGTCGGGTGTCGATTATCTTCACCTCTTGATCGTTAGCATG
GACTATCTTATCCGACGATTCAACATTCAGGCCCGCTTGGCCATCACTGTTCACGATGAAATTCGCTACCTTGTC
AAAGATGAGGATAGGTATCGCGCTGCAATGGCTTTGCAGATTGCCAACGTTTGGACTCGTGCCTTATTCTCTCAG
CAAGTAGGAATTGATGACCTCCCCCAATCATGTGCCTACTTCTCCGCCGTCGACATTGACCATGTCCTTCGCAAA
GAAGTCGACATGGACTGTGTGACCCCTTCTCATCCTCACAAAATTCCGCATGGTGAAACGCTGGATATTACTCAG
CTCCTAGACAAGGATCAGGAAGCTTTCTTGGACCCGTCCATCACACCCCAGTCGCCTCCAAATCCCGACAAATAC
CCATACACTCCACGGGAGTCGGTCATGTCCGCTTTCCAAGCTTCCAATGACATTGATTTCATCAAAGCTCAAATC
ACCAAAGATGACAAAGAGCTTCGCGATATCATCAAGGAGAAGACGCGCGCAGCTGCTAGTGTCATCGCTCCTACT
CCTCGCACCCCTTCTACCAAACCGAAAGGTACTTCTACCAATTGGAGCTCGGCAAAGCCCCAGCGGGCGGTTCTG
ATGGACATGGAGTCAGGCCTCTATCCCGACTTCCACGGCTCCCGGCCTAGTTTTCATGGGAATAAACAGCCTCAA
ATTGGACTCCACCGTCCTCCCTGGAAACCACGGGCAATAGCCCGAGTATAA
Transcript >Pro_DTO377G3_2|g374.t1
ATGTTATCTTGGAAGTTCTCCTGCACTCCTTGTTCCAAGGGTGCCGTGGAATCTTTCTTGCGACGAAGCTCGCCG
TTCCTGGTTAAGCCGCCATCGTGCTACCAGTCAGACAGAAGTCATACAAGATTATTCTCTACTTCCGCCGACAAT
GTGACCACAAGACGATCTCTTTCTGTCCCTTCCTCATCCAGATTCAATGACATCGGAGTCCAACAGCTCAGCGAC
CATGTCCATGCTCAAGTTTTCCCCAACAAAGGTCGCGTTCCGGACCCAGAACTAGTCGCTCTCTCGAAGGATCAT
TTAGCTCGACATGAGCTCCTGGGCAAATCTCAAAATGGCGCCGGTCCTATCGCATTCGATCTTCCTGCTCTCAAG
GGACAAACGTTGGACGAACACTTCTACAAACTTGGAATGGATTCTTCCGAACCATACCTGTCATGGGCTAAGTCA
TATGCGGCTCTTACCTGTCCGGCCAAACCACGCAAATGGGTCCAACGCAGCGGATGGACGAAATACCACACTGAC
GGAACCTCTGAACCTGTCGACGCCCCAAATGAATCAATGTTAACATTCGACACCGAGGTCATGTACAAAGATAAT
CCATTTGCGGTCATGGCTTGCGCGGTAAGCCCGACAGCTTGGTATGCATGGATATCACCGTGGCTGCTTGGCGAG
TCAGAGAATCAAGTACAGCTGATACCCTTGGGAGACCCCACTCAATCTCGCATTGTGGTTGGCCACAATATTGGT
TACGACCGAGCCCGAGTCCTTGAGGAATACAACATGCAGCAGTCTCAAAACTTCTTTCTCGACACAATGTCCCTA
CATGTGGCGGTCAACGGCATGTGTTCGCAACAGAGACCGACTTGGATGCGCCACAAAAAGAATCAGGACATGAGA
GATAAAATCGCGAATGACCACGATTCTGTGGAGCTTGCCGCACTTCTCGAAAACAACATGTTGAGAGAAGAAGAG
GAGGAGCTTTGGGTTGGGCGAAGCTCGGTGAACTCCCTGCGTGATGTGGCCAAATTCCATTGTGATGTCACTATC
GATAAGGCGCAGAGAGATCTGTTCGGTGAACTTGATCGTGACTCTATTGTGGCCAGACTGGAGGAACTTCTCGAC
TATTGTGCTGCCGATGTTGCCATCACCCACCGTGTCTACCGAAAAGTTTTCCCCAATTTTCTCGAGACTTGCCCG
CATCCCGTCAGTTTCGGTGCTCTTCGACACTTATCCTCCGTCATTTTACCAGTCAATGAGTCATGGGAAGAGTAT
CTTACCAGCGCAGAGGAAACATATCATAAGCGGCTGGACGATGTCCAGAGTAAACTACTAGCACTATGCGACGAA
GCATTGAAGTATAAAGACCAACCAGACATTTACACGATTGATCCTTGGCTACAACAGCTGGACTGGTCCGGCCAG
GAGATCAAAATGGCCAAAGGAAAGAAGAAGGGTGATCCACCTCGGCCGGCAGCGAGGCAAAAGAAACCAGGAATG
CCCAAGTGGTACAAGGATCTTTTTACCTCCAACGCCGCCGATATTAACTTGACGGTGCGGACTCGCATTGCGCCA
ATTCTGCTCAAACTTTCCTGGGACAACTATCCTCTTGTTTGGTCGGACCTGCACGGATGGACTTTCCGCGTTCCT
CGTGATCAAATCAAACAGTATGAGAATCAGCCAGTCGTCATGTGCGATATGACCGAGGAAAAGAACACCGAGTTG
CGAGACGATAGAAAAGCCATATACTTCAAAATCCCCCACAAGGACGGCCCACAAGCTAGGTGTACCAATCCGCTT
GGAAAAGGGTATATGCAGTATTTCGAACGTGGGATCCTGTCATCTCAGTATGAACTTGCCAAACAAGCGCTGGAT
ATGAATGCGTCATGTTCTTATTGGATCAGCGCCCGGGATCGAATCAAGGGTCAAATCGTGGTCTATGAAGATCAG
GCGCAAAAAGGCAGAGAGAAAAGTGAAGCCGGCGATAATCGTATCGGATTTATTCTGCCTCAAGTCATTCCAATG
GGGACCATCACTCGACGCGCCGTGGAAAATACTTGGTTGACTGCAAGTAATGCGAAGGCCAACCGTGTTGGGTCA
GAGCTAAAAGCTATGATCAAAGCACCGCCGGGCTACTCGTTCGTTGGAGCCGATGTCGACTCCCAGGAATTATGG
ATTGCAAGTCTTGTCGGAGATGCCCCATTCCAGATTCACGGAGGAAACGCAATCGGCTTCATGTGCTTAGAAGGG
TCTAAAGCTGAGGGGACGGATCTTCACTCACGAAGTGCGTCGATTCTGGGAATCTCGCGGAATGACGCCAAGGTC
TTCAACTACGGCCGAATCTACGGGGCAGGCGTCAAGTTCGCCGCTACTTTACTTCGCCAGTTCAATCCGTCTCTA
ACTGAAAAGCAGACACAAGAGACTGCCAAGAACCTGTACAAAGAGACTAAGGGAACGCGCACTTCACGTCGCCTC
TTGAGTGAGACGCCGTTTTGGCGAGGTGGCACTGAATCCTTTGTGTTCAATAAACTCGAAGAGTTTGCGGATCAG
GAACGACCTAGAACCCCTGCTTTGGGTGCTGGGATCACTGAGGCGCTCATGCGACGTTTCATTAATAAAGGCAGC
TTCATGACATCCCGAATCAATTGGGCTATTCAGTCGTCGGGTGTCGATTATCTTCACCTCTTGATCGTTAGCATG
GACTATCTTATCCGACGATTCAACATTCAGGCCCGCTTGGCCATCACTGTTCACGATGAAATTCGCTACCTTGTC
AAAGATGAGGATAGGTATCGCGCTGCAATGGCTTTGCAGATTGCCAACGTTTGGACTCGTGCCTTATTCTCTCAG
CAAGTAGGAATTGATGACCTCCCCCAATCATGTGCCTACTTCTCCGCCGTCGACATTGACCATGTCCTTCGCAAA
GAAGTCGACATGGACTGTGTGACCCCTTCTCATCCTCACAAAATTCCGCATGGTGAAACGCTGGATATTACTCAG
CTCCTAGACAAGGATCAGGAAGCTTTCTTGGACCCGTCCATCACACCCCAGTCGCCTCCAAATCCCGACAAATAC
CCATACACTCCACGGGAGTCGGTCATGTCCGCTTTCCAAGCTTCCAATGACATTGATTTCATCAAAGCTCAAATC
ACCAAAGATGACAAAGAGCTTCGCGATATCATCAAGGAGAAGACGCGCGCAGCTGCTAGTGTCATCGCTCCTACT
CCTCGCACCCCTTCTACCAAACCGAAAGGTACTTCTACCAATTGGAGCTCGGCAAAGCCCCAGCGGGCGGTTCTG
ATGGACATGGAGTCAGGCCTCTATCCCGACTTCCACGGCTCCCGGCCTAGTTTTCATGGGAATAAACAGCCTCAA
ATTGGACTCCACCGTCCTCCCTGGAAACCACGGGCAATAGCCCGAGTATAA
Gene >Pro_DTO377G3_2|g374.t1
ATGTTATCTTGGAAGTTCTCCTGCACTCCTTGTTCCAAGGGTGCCGTGGAATCTTTCTTGCGACGAAGCTCGCCG
TTCCTGGTTAAGCCGCCATCGTGCTACCAGTCAGACAGAAGTCATACAAGATTATTCTCTACTTCCGCCGACAAT
GTGACCACAAGACGATCTCTTTCTGGTGGGTGCCCTGTCTTTTGCGCTTCTCGATAAGAAAACAATCAAATCGCA
ATTACTGATCTCGCGCAGTCCCTTCCTCATCCAGATTCAATGACATCGGAGTCCAACAGCTCAGCGACCATGTCC
ATGCTCAAGTTTTCCCCAACAAAGGTCGCGTTCCGGACCCAGAACTAGTCGCTCTCTCGAAGGATCATTTAGCTC
GACATGAGCTCCTGGGCAAATCTCAAAATGGCGCCGGTCCTATCGCATTCGATCTTCCTGCTCTCAAGGGACAAA
CGTTGGACGAACACTTCTACAAACTTGGAATGGATTCTTCCGAACCATACCTGTCATGGGCTAAGTCATATGCGG
CTCTTACCTGTCCGGCCAAACCACGCAAATGGGTCCAACGCAGCGGATGGACGAAATACCACACTGACGGAACCT
CTGAACCTGTCGACGCCCCAAATGAATCAATGTTAACATTCGACACCGAGGTCATGTACAAAGATAATCCATTTG
CGGTCATGGCTTGCGCGGTAAGCCCGACAGCTTGGTATGCATGGATATCACCGTGGCTGCTTGGCGAGTCAGAGA
ATCAAGTACAGCTGATACCCTTGGGAGACCCCACTCAATCTCGCATTGTGGTTGGCCACAATATTGGTTACGACC
GAGCCCGAGTCCTTGAGGAATACAACATGCAGCAGTCTCAAAACTTCTTTCTCGACACAATGTCCCTACATGTGG
CGGTCAACGGCATGTGTTCGCAACAGAGACCGACTTGGATGCGCCACAAAAAGAATCAGGACATGAGAGATAAAA
TCGCGAATGACCACGATTCTGTGGAGCTTGCCGCACTTCTCGAAAACAACATGTTGAGAGAAGAAGAGGAGGAGC
TTTGGGTTGGGCGAAGCTCGGTGAACTCCCTGCGTGATGTGGCCAAATTCCATTGTGATGTCACTATCGATAAGG
CGCAGAGAGATCTGTTCGGTGAACTTGATCGTGACTCTATTGTGGCCAGACTGGAGGAACTTCTCGACTATTGTG
CTGCCGATGTTGCCATCACCCACCGTGTCTACCGAAAAGTTTTCCCCAATTTTCTCGAGACTTGCCCGCATCCCG
TCAGTTTCGGTGCTCTTCGACACTTATCCTCCGTCATTTTACCAGTCAATGAGTCATGGGAAGAGTATCTTACCA
GCGCAGAGGAAACATATCATAAGCGGCTGGACGATGTCCAGAGTAAACTACTAGCACTATGCGACGAAGCATTGA
AGTATAAAGACCAACCAGACATTTACACGATTGATCCTTGGCTACAACAGCTGGACTGGTCCGGCCAGGAGATCA
AAATGGCCAAAGGAAAGAAGAAGGGTGATCCACCTCGGCCGGCAGCGAGGCAAAAGAAACCAGGAATGCCCAAGT
GGTACAAGGATCTTTTTACCTCCAACGCCGCCGATATTAACTTGACGGTGCGGACTCGCATTGCGCCAATTCTGC
TCAAACTTTCCTGGGACAACTATCCTCTTGTTTGGTCGGACCTGCACGGATGGACTTTCCGCGTTCCTCGTGATC
AAATCAAACAGTATGAGAATCAGCCAGTCGTCATGTGCGATATGACCGAGGAAAAGAACACCGAGTTGCGAGACG
ATAGAAAAGCCATATACTTCAAAATCCCCCACAAGGACGGCCCACAAGCTAGGTGTACCAATCCGCTTGGAAAAG
GGTATATGCAGTATTTCGAACGTGGGATCCTGTCATCTCAGTATGAACTTGCCAAACAAGCGCTGGATATGAATG
CGTCATGTTCTTATTGGATCAGCGCCCGGGATCGAATCAAGGGTCAAATCGTGGTCTATGAAGATCAGGCGCAAA
AAGGCAGAGAGAAAAGTGAAGCCGGCGATAATCGTATCGGATTTATTCTGCCTCAAGTCATTCCAATGGGGACCA
TCACTCGACGCGCCGTGGAAAATACTTGGTTGACTGCAAGTAATGCGAAGGCCAACCGTGTTGGGTCAGAGCTAA
AAGCTATGATCAAAGCACCGCCGGGCTACTCGTTCGTTGGAGCCGATGTCGACTCCCAGGAATTATGGATTGCAA
GTCTTGTCGGAGATGCCCCATTCCAGATTCACGGAGGAAACGCAATCGGCTTCATGTGCTTAGAAGGGTCTAAAG
CTGAGGGGACGGATCTTCACTCACGAAGTGCGTCGATTCTGGGAATCTCGCGGAATGACGCCAAGGTCTTCAACT
ACGGCCGAATCTACGGGGCAGGCGTCAAGTTCGCCGCTACTTTACTTCGCCAGTTCAATCCGTCTCTAACTGAAA
AGCAGACACAAGAGACTGCCAAGAACCTGTACAAAGAGACTAAGGGAACGCGCACTTCACGTCGCCTCTTGAGTG
AGACGCCGTTTTGGCGAGGTGGCACTGAATCCTTTGTGTTCAATAAACTCGAAGAGTTTGCGGATCAGGAACGAC
CTAGAACCCCTGCTTTGGGTGCTGGGATCACTGAGGCGCTCATGCGACGTTTCATTAATAAAGGCAGCTTCATGA
CATCCCGAATCAATTGGGCTATTCAGTCGTCGGGTGTCGATTATCTTCACCTCTTGATCGTTAGCATGGACTATC
TTATCCGACGATTCAACATTCAGGCCCGCTTGGCCATCACTGTTCACGATGAAATTCGCTACCTTGTCAAAGATG
AGGATAGGTATCGCGCTGCAATGGCTTTGCAGATTGCCAACGTTTGGACTCGTGCCTTATTCTCTCAGCAAGTAG
GAATTGATGACCTCCCCCAATCATGTGCCTACTTCTCCGCCGTCGACATTGACCATGTCCTTCGCAAAGAAGTCG
ACATGGACTGTGTGACCCCTTCTCATCCTCACAAAATTCCGCATGGTGAAACGCTGGATATTACTCAGCTCCTAG
ACAAGGATCAGGAAGCTTTCTTGGACCCGTCCATCACACCCCAGTCGCCTCCAAATCCCGACAAATACCCATACA
CTCCACGGGAGTCGGTCATGTCCGCTTTCCAAGCTTCCAATGACATTGATTTCATCAAAGCTCAAATCACCAAAG
ATGACAAAGAGCTTCGCGATATCATCAAGGAGAAGACGCGCGCAGCTGCTAGTGTCATCGCTCCTACTCCTCGCA
CCCCTTCTACCAAACCGAAAGGTACTTCTACCAATTGGAGCTCGGCAAAGCCCCAGCGGGCGGTTCTGATGGACA
TGGAGTCAGGCCTCTATCCCGACTTCCACGGCTCCCGGCCTAGTTTTCATGGGAATAAACAGCCTCAAATTGGAC
TCCACCGTCCTCCCTGGAAACCACGGGCAATAGCCCGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail