Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3738.t1
Gene name
Locationscaffold_06:607963..609717
Strand-
Gene length (bp)1754
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.7E-39 51 434

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 129 151 22
3 156 178 22
4 185 207 22
5 227 249 22
6 262 284 22
7 304 323 19
8 344 366 22
9 376 398 22
10 411 433 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3738.t1
MSVPEAPHPIQDYEVYNDSTDMEKKAYPVDPPDDPFGNEESGEVKYRIMPWWQAGTLMVAENISLGILSLPSAVA
TLGIIPAFVIIMFLSAISWYTGYTMGQFKQRYPQVHSMGDAGELLLGPIGREIFFVGQLLFIIFLMASHILTFSV
LFNTITNHGTCTIVFGVVGLVVSCVAALPRTAEKVFWMSIISAISILVATIVTMISIGVQAPSDVQNDIVATPTF
QEGFLAVTNIVFAFIAHVSFFGIMSEMQDPRDFPKALAMLQVIDTTMYVVTAMVIYCYAGPTVESPALSSAGPIM
KKVAYGLAIPTVIVAGVVFGHVACKYIYVRIFRGDRSHHMHQKTFLATGTWVAIGLTTWTVAWVIAESIPVFNEL
LSLISALFGSWFSYGLPAIFWFMMNKGKLFSSTRKIALTIINLAILGIACTICGLGLYVSGVAINESSSNASWTC
ANNAT*
Coding >Pro_DTO377G3_2|g3738.t1
ATGAGTGTCCCCGAAGCACCCCATCCTATTCAGGACTACGAAGTGTACAATGACTCAACCGACATGGAGAAGAAG
GCGTACCCGGTCGACCCCCCGGATGATCCCTTTGGGAACGAAGAATCTGGGGAAGTAAAGTATCGTATTATGCCA
TGGTGGCAAGCTGGAACGTTGATGGTTGCTGAAAACATTTCGCTGGGTATTCTATCTCTTCCATCCGCAGTAGCA
ACCCTCGGAATCATCCCAGCATTTGTCATTATTATGTTTTTGTCCGCCATCTCGTGGTACACTGGATACACCATG
GGCCAGTTCAAGCAGCGTTATCCCCAGGTCCACAGCATGGGCGATGCGGGCGAGCTTCTTCTAGGCCCTATCGGA
CGCGAGATTTTCTTTGTCGGCCAGCTGCTGTTCATCATCTTCTTGATGGCCAGCCACATTCTCACATTCTCGGTG
TTGTTCAACACCATCACGAACCACGGTACCTGCACTATTGTATTTGGAGTTGTCGGCTTGGTCGTCAGCTGTGTT
GCGGCCCTCCCGCGGACAGCAGAGAAGGTCTTTTGGATGTCCATCATCTCTGCCATCAGTATCCTGGTAGCCACT
ATCGTCACGATGATTTCCATCGGTGTGCAGGCGCCCTCTGATGTCCAGAACGATATCGTCGCGACCCCGACCTTC
CAGGAAGGCTTCTTGGCGGTTACCAACATCGTCTTTGCCTTCATTGCTCACGTGTCTTTCTTCGGTATCATGTCG
GAGATGCAGGATCCCCGCGATTTCCCCAAGGCCCTCGCTATGCTCCAGGTTATCGATACTACTATGTATGTTGTG
ACGGCTATGGTAATCTACTGCTATGCGGGCCCGACTGTCGAGTCTCCGGCTCTATCGTCGGCTGGACCTATAATG
AAGAAAGTTGCCTATGGCCTGGCAATCCCAACGGTCATTGTTGCCGGTGTTGTTTTCGGCCATGTTGCATGCAAG
TACATCTATGTTCGAATCTTCCGCGGCGATCGCTCCCACCACATGCACCAGAAGACTTTCTTGGCTACAGGTACA
TGGGTCGCGATCGGCCTGACTACCTGGACTGTTGCGTGGGTCATTGCAGAGTCCATTCCAGTGTTCAACGAGTTG
TTGAGTTTGATTAGTGCCCTATTCGGAAGCTGGTTTAGCTACGGCCTCCCTGCCATTTTCTGGTTCATGATGAAC
AAGGGAAAGTTGTTCTCTTCAACTAGAAAGATAGCCCTGACTATTATCAACTTGGCCATTCTTGGAATTGCTTGT
ACTATTTGTGGATTGGGACTCTATGTCTCGGGCGTGGCTATCAACGAGAGCTCGTCCAATGCCAGCTGGACCTGT
GCCAACAATGCCACCTAG
Transcript >Pro_DTO377G3_2|g3738.t1
ATGAGTGTCCCCGAAGCACCCCATCCTATTCAGGACTACGAAGTGTACAATGACTCAACCGACATGGAGAAGAAG
GCGTACCCGGTCGACCCCCCGGATGATCCCTTTGGGAACGAAGAATCTGGGGAAGTAAAGTATCGTATTATGCCA
TGGTGGCAAGCTGGAACGTTGATGGTTGCTGAAAACATTTCGCTGGGTATTCTATCTCTTCCATCCGCAGTAGCA
ACCCTCGGAATCATCCCAGCATTTGTCATTATTATGTTTTTGTCCGCCATCTCGTGGTACACTGGATACACCATG
GGCCAGTTCAAGCAGCGTTATCCCCAGGTCCACAGCATGGGCGATGCGGGCGAGCTTCTTCTAGGCCCTATCGGA
CGCGAGATTTTCTTTGTCGGCCAGCTGCTGTTCATCATCTTCTTGATGGCCAGCCACATTCTCACATTCTCGGTG
TTGTTCAACACCATCACGAACCACGGTACCTGCACTATTGTATTTGGAGTTGTCGGCTTGGTCGTCAGCTGTGTT
GCGGCCCTCCCGCGGACAGCAGAGAAGGTCTTTTGGATGTCCATCATCTCTGCCATCAGTATCCTGGTAGCCACT
ATCGTCACGATGATTTCCATCGGTGTGCAGGCGCCCTCTGATGTCCAGAACGATATCGTCGCGACCCCGACCTTC
CAGGAAGGCTTCTTGGCGGTTACCAACATCGTCTTTGCCTTCATTGCTCACGTGTCTTTCTTCGGTATCATGTCG
GAGATGCAGGATCCCCGCGATTTCCCCAAGGCCCTCGCTATGCTCCAGGTTATCGATACTACTATGTATGTTGTG
ACGGCTATGGTAATCTACTGCTATGCGGGCCCGACTGTCGAGTCTCCGGCTCTATCGTCGGCTGGACCTATAATG
AAGAAAGTTGCCTATGGCCTGGCAATCCCAACGGTCATTGTTGCCGGTGTTGTTTTCGGCCATGTTGCATGCAAG
TACATCTATGTTCGAATCTTCCGCGGCGATCGCTCCCACCACATGCACCAGAAGACTTTCTTGGCTACAGGTACA
TGGGTCGCGATCGGCCTGACTACCTGGACTGTTGCGTGGGTCATTGCAGAGTCCATTCCAGTGTTCAACGAGTTG
TTGAGTTTGATTAGTGCCCTATTCGGAAGCTGGTTTAGCTACGGCCTCCCTGCCATTTTCTGGTTCATGATGAAC
AAGGGAAAGTTGTTCTCTTCAACTAGAAAGATAGCCCTGACTATTATCAACTTGGCCATTCTTGGAATTGCTTGT
ACTATTTGTGGATTGGGACTCTATGTCTCGGGCGTGGCTATCAACGAGAGCTCGTCCAATGCCAGCTGGACCTGT
GCCAACAATGCCACCTAG
Gene >Pro_DTO377G3_2|g3738.t1
ATGAGTGTCCCCGAAGCACCCCATCCTATTCAGGACTACGAAGTGTACAATGACTCAACCGACATGGAGAAGAAG
GCGTACCCGGTCGACCCCCCGGATGATCCCTTTGGGAACGAAGAATCTGGGGAAGTAAAGTATCGTATTATGCCA
TGGTGGTCAGTATCTCACTCTGTTTACTATTTTTATTGCATCAAAGAGCACATTTCTGACTTTTATATACAGGCA
AGCTGGAACGTGTGAGAGCCCATCATTAACCCTAGTCAACAGGAACCCCATTCTAACACTGTTCATGTAGTGATG
GTTGCTGAAAACATTTCGCTGGGTATTCTATCTCTTCCATCCGCAGTAGCAACCCTCGGAATCATCCCGTAAGAA
AATTTCTACCTCCACGATGCAGAAAGAAGGCTGACATCTCCCAGAGCATTTGTCATTATTATGTTTTTGTCCGCC
ATCTCGTGGTACACTGGATACACCATGGGCCAGTTCAAGCAGCGTTATCCCCAGGTCCACAGCATGGGCGATGCG
GGCGAGCTTCTTCTAGGCCCTATCGGACGCGAGATTTTCTTTGTCGGCCAGCTGCTGTTCATCATCTTCTTGATG
GCCAGCCACATTCTCACATTCTCGGTGTTGTTCAACACCATCACGAACCACGGTACCTGCACTATTGTATTTGGA
GTTGTCGGCTTGGTCGTCAGCTGTGTTGCGGCCCTCCCGCGGACAGCAGAGAAGGTCTTTTGGATGTCCATCATC
TCTGCCATCAGTATCCTGGTAGCCACTATCGTCACGATGATTTCCATCGGTGTGCAGGCGCCCTCTGATGTCCAG
AACGATATCGTCGCGACCCCGACCTTCCAGGAAGGCTTCTTGGCGGTTACCAACATCGTCTTTGCCTTCATTGCT
CACGTGTCTTTCTTCGGTATCATGTCGGAGATGCAGGATCCCCGCGATTTCCCCAAGGCCCTCGCTATGCTCCAG
GTTATCGATACTACTATGTATGTTGTGACGGCTATGGTAATCTACTGCTATGCGGGCCCGACTGTCGAGTCTCCG
GCTCTATCGTCGGCTGGACCTATAATGAAGAAAGTTGCCTATGGCCTGGCAATCCCAACGGTGTGTTATATCTCC
TTGCAGTCGATTCGGGAGTCTGTTCTAATCTCTGATAGGTCATTGTTGCCGGTGTTGTTTTCGGCCATGTTGCAT
GCAAGTACATCTATGTTCGAATCTTCCGCGGCGATCGCTCCCACCACATGCACCAGAAGACTTTCTTGGCTACAG
GTACATGGGTCGCGATCGGCCTGACTACCTGGACTGTTGCGTGGGTCATTGCAGAGTCCATTCCAGTGTTCAACG
AGTTGTTGAGTTTGATTGTATGTTCTATACTCATTTATTACCGTGCGTCTACTAAGTTGTTATACAGAGTGCCCT
ATTCGGAAGCTGGTTTAGCTGTAAGTCGACTTCTGAGACTAAGATTGATGCGAAATAGATTACTGACTGAGAACA
GACGGCCTCCCTGCCATTTTCTGGTTCATGATGAACAAGGGAAAGTTGTTCTCTTCAACTAGAAAGATAGCCCTG
ACTATTATCAACTTGGCCATTCTTGGAATTGCTTGTACTATTGTATGTTTTGTCTCTCTGTGTGATTCTGAATTT
CCTGCTGACAAGAATAGTGTGGATTGGGACTCTATGTCTCGGGCGTGGCTATCAACGAGAGCTCGTCCAATGCCA
GCTGGACCTGTGCCAACAATGCCACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail