Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3730.t1
Gene name
Locationscaffold_06:579476..582025
Strand-
Gene length (bp)2549
Transcript length (bp)2442
Coding sequence length (bp)2442
Protein length (aa) 814

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13688 Reprolysin_5 Metallo-peptidase family M12 1.7E-59 268 480
PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like 1.1E-48 269 489
PF13574 Reprolysin_2 Metallo-peptidase family M12B Reprolysin-like 1.1E-41 296 491
PF00200 Disintegrin Disintegrin 5.1E-17 521 595
PF13582 Reprolysin_3 Metallo-peptidase family M12B Reprolysin-like 6.7E-08 303 436

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 707 729 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3730.t1
MRFSTILPLIGALSSLFQQTQARSQASNAIRRVTPVDNAIIRTPSHQIDHLSHFDITFALHQDGKRIKLELEPNN
DILADDAYVQYVRNDGTITHSEPIKRDEHKVFRGRALVGSGKGRWTPVGWARITVQRDGLEPLFEGAFSVNDDKH
HIELQSTYLDKKRPMDADVEPRDGPSMIVYRDSDMFRYTHSELKRSLPVSEGCGANNLGYNADLSNTIFGDMDSQ
WGVVSLNSMFGLSKRQSDVGGVSGNTGGVNLKSTIGDSSGCPKTKKVALIGVATDCEFTESFMATNSTPEQAARD
WVINVVNTASNLYEESFNVSIGLRNLTIAETGCSSSGSAATPWNVDCNGGNVTWRLNEFSKWRATHSDDNAYWTL
MTNCPTGSEVGVSWMGRLCSSELVTSGANSVAGANVVVRNSGSSWQVFAHETGHTFGAVHDCDESTCADNLEASS
QCCPLSSSTCNANAQYIMNPYAESTITKFSECTIGNICSAIGKNSIKSSCLSDNRGVVTISGSQCGNGIVEGDEE
CDCGDEESCSDNSCCDPKTCKFKGSAVCDDSNDSCCDQCQFASADTVCRASTGECDIAETCSGTSSSCPANKYKD
DGASCGAKDQGLSCASGQCTSRDYQCRTVTGAVLNTNDTWACDNTGSPSCSLVCGAPSSQQSMGATSCLIMNQNY
LDGTPCDSGGRCSAGQCKGSSALGWIRQHEKLVIGICVGVGTFLLLAIFFCIYSRCKRSAQLRKARKAIPPGTYR
RYNGPQPTARPPMDQWHGYRNAGYQNMPPPGYSGYQNVPPPGVPYQNGGYQNMPPPGPPPRYA*
Coding >Pro_DTO377G3_2|g3730.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGCACGATCACAG
GCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCATCATTCGTACTCCTTCACATCAAATAGATCAC
CTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCAAGCGCATAAAGCTAGAACTCGAGCCCAATAAT
GATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACGACGGCACAATAACACATTCTGAGCCGATCAAG
CGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGATCCGGAAAGGGGAGATGGACGCCCGTAGGCTGG
GCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTGAAGGCGCTTTTAGTGTCAACGACGACAAGCAC
CACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGATGGATGCCGACGTCGAACCCAGAGATGGGCCA
TCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGCACTCCGAGCTCAAGCGGTCGCTGCCCGTATCT
GAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGTCCAATACGATTTTCGGGGATATGGACAGCCAA
TGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGCGACAGTCCGATGTTGGTGGTGTCTCGGGAAAC
ACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTGGATGTCCCAAAACGAAGAAAGTGGCCTTGATC
GGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTACAAACTCCACACCTGAACAAGCGGCTAGGGAC
TGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAGAATCTTTCAATGTGTCCATTGGTTTGCGCAAC
CTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTGCTACGCCATGGAACGTGGATTGCAACGGCGGA
AATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAACTCATTCAGATGACAATGCCTACTGGACTCTG
ATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGATGGGTCGTCTATGCTCGTCCGAACTGGTTACC
TCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCAATTCCGGTTCTTCCTGGCAGGTGTTTGCCCAC
GAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGAGCACCTGCGCGGATAACCTGGAAGCCTCGTCT
CAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGCAATACATCATGAACCCCTATGCTGAGAGCACC
ATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTGCCATTGGCAAAAATAGCATCAAGTCCTCTTGT
CTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAATGCGGCAACGGCATCGTCGAAGGCGACGAGGAG
TGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCTGTGACCCCAAGACCTGCAAATTTAAAGGCAGC
GCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCCAGTTCGCCTCCGCCGACACCGTCTGCCGCGCC
AGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCTCGAGCTCTTGTCCCGCCAACAAATACAAAGAC
GACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCGCCAGCGGCCAATGCACCAGCCGCGACTACCAG
TGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCTGGGCCTGCGATAACACAGGCAGTCCCTCCTGC
AGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTGCCACAAGTTGCCTCATCATGAACCAGAACTAT
CTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCGGCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGG
ATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTGTCGGCACGTTCCTCCTGCTCGCTATCTTCTTC
TGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGGCCCGCAAGGCTATCCCCCCTGGCACTTATCGC
CGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACCAGTGGCATGGATACCGGAATGCCGGCTATCAG
AATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTCCGCCTGGTGTCCCGTATCAAAACGGCGGGTAT
CAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA
Transcript >Pro_DTO377G3_2|g3730.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGCACGATCACAG
GCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCATCATTCGTACTCCTTCACATCAAATAGATCAC
CTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCAAGCGCATAAAGCTAGAACTCGAGCCCAATAAT
GATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACGACGGCACAATAACACATTCTGAGCCGATCAAG
CGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGATCCGGAAAGGGGAGATGGACGCCCGTAGGCTGG
GCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTGAAGGCGCTTTTAGTGTCAACGACGACAAGCAC
CACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGATGGATGCCGACGTCGAACCCAGAGATGGGCCA
TCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGCACTCCGAGCTCAAGCGGTCGCTGCCCGTATCT
GAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGTCCAATACGATTTTCGGGGATATGGACAGCCAA
TGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGCGACAGTCCGATGTTGGTGGTGTCTCGGGAAAC
ACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTGGATGTCCCAAAACGAAGAAAGTGGCCTTGATC
GGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTACAAACTCCACACCTGAACAAGCGGCTAGGGAC
TGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAGAATCTTTCAATGTGTCCATTGGTTTGCGCAAC
CTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTGCTACGCCATGGAACGTGGATTGCAACGGCGGA
AATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAACTCATTCAGATGACAATGCCTACTGGACTCTG
ATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGATGGGTCGTCTATGCTCGTCCGAACTGGTTACC
TCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCAATTCCGGTTCTTCCTGGCAGGTGTTTGCCCAC
GAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGAGCACCTGCGCGGATAACCTGGAAGCCTCGTCT
CAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGCAATACATCATGAACCCCTATGCTGAGAGCACC
ATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTGCCATTGGCAAAAATAGCATCAAGTCCTCTTGT
CTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAATGCGGCAACGGCATCGTCGAAGGCGACGAGGAG
TGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCTGTGACCCCAAGACCTGCAAATTTAAAGGCAGC
GCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCCAGTTCGCCTCCGCCGACACCGTCTGCCGCGCC
AGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCTCGAGCTCTTGTCCCGCCAACAAATACAAAGAC
GACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCGCCAGCGGCCAATGCACCAGCCGCGACTACCAG
TGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCTGGGCCTGCGATAACACAGGCAGTCCCTCCTGC
AGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTGCCACAAGTTGCCTCATCATGAACCAGAACTAT
CTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCGGCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGG
ATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTGTCGGCACGTTCCTCCTGCTCGCTATCTTCTTC
TGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGGCCCGCAAGGCTATCCCCCCTGGCACTTATCGC
CGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACCAGTGGCATGGATACCGGAATGCCGGCTATCAG
AATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTCCGCCTGGTGTCCCGTATCAAAACGGCGGGTAT
CAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA
Gene >Pro_DTO377G3_2|g3730.t1
ATGAGGTTTTCTACCATTCTGCCCTTGATCGGTGCACTGTCATCGCTCTTTCAACAAACACAAGGTAAATCCCCA
CTTGCAGCCCAGACCGTCGTTGCCCAGGCCTCCGTTGCTCAGCCCGTTGCTCAGCCCGTTGCCTAGCTCCGTTGC
CTAGCCGCTGACAATCCCCAGCACGATCACAGGCCTCAAACGCCATTCGCCGAGTGACGCCCGTCGACAATGCCA
TCATTCGTACTCCTTCACATCAAATAGATCACCTGTCACATTTTGATATCACGTTCGCCCTACACCAAGACGGCA
AGCGCATAAAGCTAGAACTCGAGCCCAATAATGATATCTTGGCCGACGACGCTTATGTGCAATACGTCCGTAACG
ACGGCACAATAACACATTCTGAGCCGATCAAGCGAGACGAGCACAAGGTTTTCCGCGGGCGCGCCTTGGTAGGAT
CCGGAAAGGGGAGATGGACGCCCGTAGGCTGGGCAAGAATCACCGTCCAAAGGGATGGCCTCGAGCCTTTATTTG
AAGGCGCTTTTAGTGTCAACGACGACAAGCACCACATTGAGCTGCAATCGACCTACCTCGACAAAAAGCGCCCGA
TGGATGCCGACGTCGAACCCAGAGATGGGCCATCGATGATCGTCTACCGTGACTCCGACATGTTTCGCTATACGC
ACTCCGAGCTCAAGCGGTCGCTGCCCGTATCTGAAGGCTGCGGCGCTAATAACCTTGGATACAATGCTGATCTGT
CCAATACGATTTTCGGGGATATGGACAGCCAATGGGGTGTGGTTTCGTTGAACTCGATGTTCGGATTAAGCAAGC
GACAGTCCGATGTTGGTGGTGTCTCGGGAAACACTGGCGGTGTGAATCTGAAATCGACCATCGGTGATTCCAGTG
GATGTCCCAAAACGAAGAAAGTGGCCTTGATCGGAGTTGCTACGGATTGTGAATTCACCGAATCCTTTATGGCTA
CAAACTCCACACCTGAACAAGCGGCTAGGGACTGGGTTATCAACGTGGTGAACACGGCTTCAAATCTCTATGAAG
AATCTTTCAATGTGTCCATTGGTTTGCGCAACCTTACAATCGCCGAGACAGGCTGCTCTAGCTCGGGCTCCGCTG
CTACGCCATGGAACGTGGATTGCAACGGCGGAAATGTCACCTGGCGCCTGAATGAATTCTCCAAGTGGCGCGCAA
CTCATTCAGATGACAATGCCTACTGGACTCTGATGACTAACTGCCCAACGGGCTCCGAGGTTGGGGTTTCATGGA
TGGGTCGTCTATGCTCGTCCGAACTGGTTACCTCTGGAGCGAACTCCGTGGCCGGTGCCAACGTCGTAGTGCGCA
ATTCCGGTTCTTCCTGGCAGGTGTTTGCCCACGAAACCGGTCACACCTTTGGAGCAGTGCACGATTGCGACGAGA
GCACCTGCGCGGATAACCTGGAAGCCTCGTCTCAATGCTGCCCGCTGAGTTCGTCAACCTGCAATGCCAATGCGC
AATACATCATGAACCCCTATGCTGAGAGCACCATCACCAAGTTTTCGGAATGTACCATCGGTAACATCTGCTCTG
CCATTGGCAAAAATAGCATCAAGTCCTCTTGTCTATCCGACAACCGCGGCGTCGTGACCATCAGCGGCAGCCAAT
GCGGCAACGGCATCGTCGAAGGCGACGAGGAGTGTGACTGCGGCGACGAAGAAAGCTGCAGCGACAACTCCTGCT
GTGACCCCAAGACCTGCAAATTTAAAGGCAGCGCCGTGTGCGATGACTCCAACGATAGCTGCTGCGATCAATGCC
AGTTCGCCTCCGCCGACACCGTCTGCCGCGCCAGCACCGGAGAATGCGACATCGCCGAGACCTGCAGCGGAACCT
CGAGCTCTTGTCCCGCCAACAAATACAAAGACGACGGTGCCAGCTGCGGCGCCAAGGACCAGGGACTCAGCTGCG
CCAGCGGCCAATGCACCAGCCGCGACTACCAGTGCCGCACAGTAACAGGCGCGGTACTGAACACCAACGACACCT
GGGCCTGCGATAACACAGGCAGTCCCTCCTGCAGTCTCGTGTGCGGCGCACCCTCATCCCAACAATCAATGGGTG
CCACAAGTTGCCTCATCATGAACCAGAACTATCTGGACGGTACACCCTGCGACTCCGGCGGCCGCTGCAGCGCCG
GCCAGTGCAAGGGCTCCTCGGCCCTGGGCTGGATCCGGCAGCACGAGAAGCTGGTTATCGGCATCTGTGTCGGTG
TCGGCACGTTCCTCCTGCTCGCTATCTTCTTCTGTATCTATAGTCGTTGCAAGCGCAGTGCACAGCTGCGTAAGG
CCCGCAAGGCTATCCCCCCTGGCACTTATCGCCGCTATAATGGGCCCCAGCCTACTGCCCGCCCGCCTATGGACC
AGTGGCATGGATACCGGAATGCCGGCTATCAGAATATGCCTCCCCCTGGTTATTCCGGGTATCAGAATGTCCCTC
CGCCTGGTGTCCCGTATCAAAACGGCGGGTATCAGAATATGCCTCCCCCTGGTCCCCCGCCACGATACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail