Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g373.t1
Gene name
Locationscaffold_01:946918..949040
Strand-
Gene length (bp)2122
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 2.6E-18 509 607

GO

GO Term Description Terminal node
GO:0030001 metal ion transport Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 558 580 22
2 590 608 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g373.t1
MSIHSVDYAQQGPTRPEVDVEAGRPSVSSQVAPTVGEREGAASPAFTTAARVNSTETTKRRARRNTARSYHPEGF
AQDPNWQPGTEPGIDPTKPLPPYTSEWSSNIPADLQRRCQITVVDFSQHEMRQYELDNDTLEQFLQREKEPWVQC
RWINVNGLSWDVIKILGNHKRLHRLAIEDVVHDTNRTKVDWYSDHAFVVLTLQKLVKIQEEDSSDSEDEEENPVS
PWKSRDRKSSVVSDKSSISLRRPTKWSVIMAALKDIFRFRSSTKQERKDMAKYGSSVRPGLGQNSTQNSHFGNVG
ATTDTSARSLQRYRGGPNEDRIEFMERHAALSAKGLCVTLEQVSIFLHTDNEVTSFFETSADDIESPIVRRLNTP
ETILRQSCDASMLLQAILDAVIDLAIPVTMAYQDAIGDLELEVLTDPDIEQSKSLYILTSEIAVLRNHMQPIVAV
INALRDHRSEPVGTPGFGVLRNPLSPGATPAEFLDPRPHIGTVPPNLKSVGGTGVTISSMCHTYLGDALDHCITI
VEGYDQMRRNADNMIDLIFNTIGAYQNESMKQLTLVTCLYLPMTFLTGYFGMNFTHFAGIEHSEGYFWKIAVPFV
LVTIFYLMRDKIQRYAVMLAQRRLIVSSRKQRRERTKK*
Coding >Pro_DTO377G3_2|g373.t1
ATGAGCATACACTCAGTCGATTATGCACAGCAGGGTCCGACACGACCCGAGGTCGATGTTGAGGCGGGTCGCCCG
TCAGTCAGTTCCCAAGTCGCTCCAACAGTAGGAGAGAGAGAGGGAGCCGCGTCTCCCGCATTCACCACAGCAGCA
CGAGTGAACTCCACCGAGACGACAAAACGCCGAGCCAGACGCAATACCGCCCGCTCATACCACCCCGAAGGATTC
GCACAAGATCCCAATTGGCAACCAGGAACCGAACCCGGCATTGACCCAACCAAGCCGCTACCGCCATACACGTCA
GAATGGTCGTCCAACATACCAGCGGACCTACAACGACGCTGCCAGATCACCGTGGTGGACTTCTCACAACATGAA
ATGCGACAGTATGAGTTAGACAATGACACACTGGAGCAATTTTTGCAGCGGGAGAAAGAGCCCTGGGTGCAATGC
CGGTGGATCAATGTCAATGGGTTGAGCTGGGATGTGATCAAGATTCTTGGAAATCATAAGAGATTGCATCGGCTT
GCAATTGAGGATGTTGTCCATGACACTAACCGCACGAAAGTGGATTGGTACTCGGACCATGCCTTCGTTGTACTG
ACATTGCAAAAGTTGGTGAAGATACAAGAAGAGGACTCCTCTGATTCGGAAGATGAGGAGGAAAATCCAGTCAGT
CCATGGAAGTCAAGGGACCGGAAAAGTTCTGTGGTCAGTGACAAGAGCTCGATTTCGTTGAGGCGACCCACGAAG
TGGAGTGTTATTATGGCGGCATTGAAGGACATTTTCAGGTTCAGATCCTCCACAAAACAGGAGCGCAAGGATATG
GCGAAATATGGATCGAGCGTTCGTCCTGGGCTTGGACAAAATTCAACACAAAATTCCCATTTTGGAAATGTTGGG
GCCACCACAGACACATCTGCCAGGAGTCTTCAGCGATATCGCGGTGGTCCGAATGAAGATCGAATTGAGTTCATG
GAACGCCATGCTGCACTTTCTGCCAAAGGATTATGTGTCACTTTGGAACAAGTTTCGATCTTCCTACATACCGAT
AATGAGGTGACCTCCTTTTTTGAAACGAGCGCGGATGACATCGAGTCGCCAATTGTCAGGCGCCTCAATACGCCA
GAGACTATCCTTCGACAGTCATGCGATGCCAGTATGCTTTTGCAGGCCATTCTGGATGCTGTGATTGATCTTGCG
ATTCCAGTAACGATGGCTTATCAAGACGCCATCGGAGACCTCGAGCTGGAGGTTCTGACTGATCCAGACATTGAA
CAGTCAAAGTCCTTATATATTTTGACATCTGAGATTGCTGTTCTGCGGAACCATATGCAGCCTATAGTGGCTGTG
ATTAACGCTCTCCGTGATCACCGGTCTGAGCCCGTCGGCACACCAGGCTTTGGTGTCCTAAGGAATCCCCTTAGC
CCAGGTGCAACTCCTGCAGAATTTCTTGATCCCCGCCCACATATTGGGACTGTACCGCCAAATCTGAAGAGTGTC
GGAGGCACAGGTGTTACGATCAGCTCTATGTGCCATACATATTTGGGCGATGCCCTAGATCATTGCATTACTATC
GTTGAAGGGTACGATCAGATGCGGCGCAACGCTGATAACATGATTGACCTCATTTTCAACACTATTGGTGCCTAC
CAGAACGAAAGTATGAAGCAGCTTACTCTTGTGACTTGTCTTTATCTTCCTATGACATTCTTGACAGGTTATTTC
GGAATGAACTTCACGCATTTCGCGGGAATCGAACACAGTGAAGGATATTTCTGGAAGATTGCAGTGCCGTTCGTC
CTCGTTACGATTTTCTACCTGATGCGCGACAAAATACAACGCTACGCTGTCATGCTTGCTCAGCGACGTTTGATT
GTTAGCTCGAGGAAGCAGAGACGAGAGAGGACGAAGAAATAG
Transcript >Pro_DTO377G3_2|g373.t1
ATGAGCATACACTCAGTCGATTATGCACAGCAGGGTCCGACACGACCCGAGGTCGATGTTGAGGCGGGTCGCCCG
TCAGTCAGTTCCCAAGTCGCTCCAACAGTAGGAGAGAGAGAGGGAGCCGCGTCTCCCGCATTCACCACAGCAGCA
CGAGTGAACTCCACCGAGACGACAAAACGCCGAGCCAGACGCAATACCGCCCGCTCATACCACCCCGAAGGATTC
GCACAAGATCCCAATTGGCAACCAGGAACCGAACCCGGCATTGACCCAACCAAGCCGCTACCGCCATACACGTCA
GAATGGTCGTCCAACATACCAGCGGACCTACAACGACGCTGCCAGATCACCGTGGTGGACTTCTCACAACATGAA
ATGCGACAGTATGAGTTAGACAATGACACACTGGAGCAATTTTTGCAGCGGGAGAAAGAGCCCTGGGTGCAATGC
CGGTGGATCAATGTCAATGGGTTGAGCTGGGATGTGATCAAGATTCTTGGAAATCATAAGAGATTGCATCGGCTT
GCAATTGAGGATGTTGTCCATGACACTAACCGCACGAAAGTGGATTGGTACTCGGACCATGCCTTCGTTGTACTG
ACATTGCAAAAGTTGGTGAAGATACAAGAAGAGGACTCCTCTGATTCGGAAGATGAGGAGGAAAATCCAGTCAGT
CCATGGAAGTCAAGGGACCGGAAAAGTTCTGTGGTCAGTGACAAGAGCTCGATTTCGTTGAGGCGACCCACGAAG
TGGAGTGTTATTATGGCGGCATTGAAGGACATTTTCAGGTTCAGATCCTCCACAAAACAGGAGCGCAAGGATATG
GCGAAATATGGATCGAGCGTTCGTCCTGGGCTTGGACAAAATTCAACACAAAATTCCCATTTTGGAAATGTTGGG
GCCACCACAGACACATCTGCCAGGAGTCTTCAGCGATATCGCGGTGGTCCGAATGAAGATCGAATTGAGTTCATG
GAACGCCATGCTGCACTTTCTGCCAAAGGATTATGTGTCACTTTGGAACAAGTTTCGATCTTCCTACATACCGAT
AATGAGGTGACCTCCTTTTTTGAAACGAGCGCGGATGACATCGAGTCGCCAATTGTCAGGCGCCTCAATACGCCA
GAGACTATCCTTCGACAGTCATGCGATGCCAGTATGCTTTTGCAGGCCATTCTGGATGCTGTGATTGATCTTGCG
ATTCCAGTAACGATGGCTTATCAAGACGCCATCGGAGACCTCGAGCTGGAGGTTCTGACTGATCCAGACATTGAA
CAGTCAAAGTCCTTATATATTTTGACATCTGAGATTGCTGTTCTGCGGAACCATATGCAGCCTATAGTGGCTGTG
ATTAACGCTCTCCGTGATCACCGGTCTGAGCCCGTCGGCACACCAGGCTTTGGTGTCCTAAGGAATCCCCTTAGC
CCAGGTGCAACTCCTGCAGAATTTCTTGATCCCCGCCCACATATTGGGACTGTACCGCCAAATCTGAAGAGTGTC
GGAGGCACAGGTGTTACGATCAGCTCTATGTGCCATACATATTTGGGCGATGCCCTAGATCATTGCATTACTATC
GTTGAAGGGTACGATCAGATGCGGCGCAACGCTGATAACATGATTGACCTCATTTTCAACACTATTGGTGCCTAC
CAGAACGAAAGTATGAAGCAGCTTACTCTTGTGACTTGTCTTTATCTTCCTATGACATTCTTGACAGGTTATTTC
GGAATGAACTTCACGCATTTCGCGGGAATCGAACACAGTGAAGGATATTTCTGGAAGATTGCAGTGCCGTTCGTC
CTCGTTACGATTTTCTACCTGATGCGCGACAAAATACAACGCTACGCTGTCATGCTTGCTCAGCGACGTTTGATT
GTTAGCTCGAGGAAGCAGAGACGAGAGAGGACGAAGAAATAG
Gene >Pro_DTO377G3_2|g373.t1
ATGAGCATACACTCAGTCGATTATGCACAGCAGGGTCCGACACGACCCGAGGTCGATGTTGAGGCGGGTCGCCCG
TCAGTCAGTTCCCAAGTCGCTCCAACAGTAGGAGAGAGAGAGGGAGCCGCGTCTCCCGCATTCACCACAGCAGCA
CGAGTGAACTCCACCGAGACGACAAAACGCCGAGCCAGACGCAATACCGCCCGCTCATACCACCCCGAAGGATTC
GCACAAGATCCCAATTGGCAACCAGGAACCGAACCCGGCATTGACCCAACCAAGCCGCTACCGCCATACACGTCA
GAATGGTCGTCCAACATACCAGCGGACCTACAACGACGCTGCCAGATCACCGTGGTGGACTTCTCACAACATGAA
ATGCGACAGTATGAGTTAGACAATGACACACTGGAGCAATTTTTGCAGCGGGAGAAAGAGCCCTGGGTGCAATGC
CGGTGGATCAATGTCAATGGGTTGAGCTGGGATGTGATCAAGATTCTTGGAAATCATAAGAGATTGCATCGGCTT
GCAATTGAGGATGTTGTCCATGACACTAACCGCACGAAAGTGGATTGGTACTCGGACCATGCCTTCGTTGTACTG
ACATTGCAAAAGTTGGTGAAGATACAAGAAGAGGACTCCTCTGATTCGGAAGATGAGGAGGAAAATCCAGTCAGT
CCATGGAAGTCAAGGGACCGGAAAAGTTCTGTGGTCAGTGACAAGAGCTCGATTTCGTTGAGGCGACCCACGAAG
TGGAGTGTTATTATGGCGGCATTGAAGGACATTTTCAGGTTCAGATCCTCCACAAAACAGGAGCGCAAGGATATG
GCGAAATATGGATCGAGCGTTCGTCCTGGGCTTGGACAAAATTCAACACAAAATTCCCATTTTGGAAATGTTGGG
GCCACCACAGACACATCTGCCAGGAGTCTTCAGCGATATCGCGGTGGTCCGAATGAAGATCGAATTGAGTTCATG
GAACGCCATGCTGCACTTTCTGCCAAAGGATTATGTGTCACTTTGGAACAAGTTTCGATCTTCCTACATACCGAT
AATGAGGTGACCTCCTTTTTTGAAACGAGCGCGGATGACATCGAGTCGCCAATTGTCAGGCGCCTCAATACGCCA
GAGACTATCCTTCGACAGTCATGCGATGCCAGTATGCTTTTGCAGGCCATTCTGGATGCTGTGATTGATCTTGCG
ATTCCAGTAACGATGGCTTATCAAGACGCCATCGGAGACCTCGAGCTGGAGGTTCTGACTGATCCAGACATTGAA
CAGTCAAAGTCCTTATATATTTTGACATCTGAGATTGCTGTTCTGCGGAACCATATGCAGCCTATAGTGGCTGTG
ATTAACGCTCTCCGTGATCACCGGTCTGAGCCCGTCGGCACACCAGGCTTTGGTGTCCTAAGGAATCCCCTTAGC
CCAGGTGCAACTCCTGCAGAATTTCTTGATCCCCGCCCACATATTGGGACTGTACCGCCAAATCTGAAGAGTGTC
GGAGGCACAGGTGTTACGATCAGCTCTATGTGCCATACATATTTGGGCGATGCCCTAGATCATTGCATTACTATC
GTTGAAGGGTACGATCAGATGCGGCGCAACGCTGATAACATGATTGACCTCATTTTCAACACTATTGGTACGTTC
AACTTCTATGGATAATTCAAGAGAAAAACAACGGACTAATATCCTGTGCAGGTGCCTACCAGAACGAAAGTATGA
AGCAGCTTACTCTTGTGACTTGTCTTTATCTTCCTATGACATTCTTGACAGTATGTATGACTTGAAACTATGAAG
AAAATCCTCTAACATTTTTAGGGTTATTTCGGAATGAACTTCACGCATTTCGCGGGAATCGAACACAGTGAAGGG
TATGTCTTTCGACCCCTTTCTTCTAGACTTGTTGCTGACTTTAGAAGATATTTCTGGAAGATTGCAGTGCCGTTC
GTCCTCGTTACGATTTTCTACCTGATGTGAGTTCTGATATTCCTCTCGAAAACAGCCGACACTAACCTGCATCTT
TAGGCGCGACAAAATACAACGCTACGCTGTCATGCTTGCTCAGCGACGTTTGATTGTTAGCTCGAGGAAGCAGAG
ACGAGAGAGGACGAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail