Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3729.t1
Gene name
Locationscaffold_06:577978..578931
Strand+
Gene length (bp)953
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 2.6E-09 194 255
PF13833 EF-hand_8 EF-hand domain pair 6.6E-07 208 254

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 97.71 57.08 138.35
5d_25C Five days - 25 degrees Celsius 83.56 47.52 119.60
7d_25C Seven days - 25 degrees Celsius 92.81 53.87 131.74
10d_25C Ten days - 25 degrees Celsius 76.39 41.92 110.86
7d_15C Seven days - 15 degrees Celsius 87.08 44.20 129.95
7d_30C Seven days - 30 degrees Celsius 91.60 52.17 131.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.592201 no
3d_25C 7d_25C 0.884710 no
3d_25C 7d_15C 0.736199 no
3d_25C 7d_30C 0.853733 no
3d_25C 10d_25C 0.365801 no
5d_25C 7d_25C 0.743772 no
5d_25C 7d_15C 0.918445 no
5d_25C 7d_30C 0.782109 no
5d_25C 10d_25C 0.795818 no
7d_25C 7d_15C 0.865063 no
7d_25C 7d_30C 0.973425 no
7d_25C 10d_25C 0.501748 no
7d_15C 7d_30C 0.897086 no
7d_15C 10d_25C 0.706697 no
7d_30C 10d_25C 0.539472 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3729.t1
MASGQPFASRSYAGTKLPERSVNTNAMPFSASSFSRHRGLGNTNQGEFPDGQKQMQQSAPAPATNAVSHGPAQDA
NPLNRLTEEQREEINEAFTLFDLDRDRHLDYHELRVAFRALGFTLGKQELISLLTTYGVPRPQVQQQQGAAGNQH
AQSQPLASNKGPVSNPQHPSNLLMPLSSFQAVTALKILERDPRDEILRAFELFDEGGKGFIDLEDLRRVARELGE
TGLEEEELRAMIEEFDLEGVGGVTREAFVGICWQ*
Coding >Pro_DTO377G3_2|g3729.t1
ATGGCCTCTGGCCAACCCTTCGCGTCGCGCTCCTACGCCGGCACGAAACTCCCAGAACGCTCCGTCAACACGAAC
GCGATGCCCTTCAGCGCCTCCTCATTCTCACGGCATCGCGGTCTGGGAAATACCAACCAAGGCGAATTTCCAGAT
GGCCAAAAGCAGATGCAGCAGTCCGCGCCCGCGCCCGCCACAAACGCCGTATCCCATGGCCCAGCGCAGGACGCG
AATCCGCTGAACAGACTCACGGAAGAGCAGAGGGAAGAGATCAACGAAGCTTTCACCCTCTTCGACCTCGACCGC
GATCGCCACCTCGACTACCACGAGCTCCGCGTCGCCTTCCGCGCTCTAGGCTTCACACTCGGCAAACAAGAGCTC
ATCTCCCTGCTAACAACGTACGGCGTACCCCGTCCCCAAGTCCAGCAACAACAAGGCGCCGCCGGCAACCAACAC
GCCCAATCCCAACCCCTCGCCTCCAACAAAGGGCCCGTCTCGAACCCGCAACATCCGTCCAATCTGCTCATGCCG
CTCTCGTCGTTCCAGGCCGTCACGGCGTTGAAGATCCTCGAGCGGGACCCGCGCGACGAGATCCTGCGCGCGTTC
GAGCTGTTCGATGAGGGCGGCAAGGGGTTCATTGACCTTGAGGATTTGAGGCGTGTTGCGAGGGAGTTGGGGGAG
ACTGGGCTTGAGGAGGAGGAGCTTAGAGCTATGATTGAGGAGTTTGATCTTGAGGGCGTTGGTGGTGTTACTCGG
GAGGCTTTTGTTGGGATTTGTTGGCAATGA
Transcript >Pro_DTO377G3_2|g3729.t1
ATGGCCTCTGGCCAACCCTTCGCGTCGCGCTCCTACGCCGGCACGAAACTCCCAGAACGCTCCGTCAACACGAAC
GCGATGCCCTTCAGCGCCTCCTCATTCTCACGGCATCGCGGTCTGGGAAATACCAACCAAGGCGAATTTCCAGAT
GGCCAAAAGCAGATGCAGCAGTCCGCGCCCGCGCCCGCCACAAACGCCGTATCCCATGGCCCAGCGCAGGACGCG
AATCCGCTGAACAGACTCACGGAAGAGCAGAGGGAAGAGATCAACGAAGCTTTCACCCTCTTCGACCTCGACCGC
GATCGCCACCTCGACTACCACGAGCTCCGCGTCGCCTTCCGCGCTCTAGGCTTCACACTCGGCAAACAAGAGCTC
ATCTCCCTGCTAACAACGTACGGCGTACCCCGTCCCCAAGTCCAGCAACAACAAGGCGCCGCCGGCAACCAACAC
GCCCAATCCCAACCCCTCGCCTCCAACAAAGGGCCCGTCTCGAACCCGCAACATCCGTCCAATCTGCTCATGCCG
CTCTCGTCGTTCCAGGCCGTCACGGCGTTGAAGATCCTCGAGCGGGACCCGCGCGACGAGATCCTGCGCGCGTTC
GAGCTGTTCGATGAGGGCGGCAAGGGGTTCATTGACCTTGAGGATTTGAGGCGTGTTGCGAGGGAGTTGGGGGAG
ACTGGGCTTGAGGAGGAGGAGCTTAGAGCTATGATTGAGGAGTTTGATCTTGAGGGCGTTGGTGGTGTTACTCGG
GAGGCTTTTGTTGGGATTTGTTGGCAATGA
Gene >Pro_DTO377G3_2|g3729.t1
ATGGCCTCTGGCCAACCCTTCGCGTCGCGCTCCTACGCCGGCACGAAACTCCCAGAACGCTCCGTCAACACGAAC
GCGATGCCCTTCAGCGCCTCCTCATTCTCACGGCATCGCGGTCTGGGAAATACCAACCAAGGCGAATTTCCAGAT
GGCCAAAAGCAGATGCAGCAGTCCGCGCCCGCGCCCGCCACAAACGCCGTATCCCATGGCCCAGCGCAGGACGCG
AATCCGCTGAACAGACTCACGGAAGAGCAGAGGGAAGAGATCAACGAAGCTGTAAGGGATACCCAATCCACCCAT
CTATGACACTACTGTTCTCCTAAATTACTGCAATATCCTGCAACCCCTCCCTCCTCCCTCTCACCTCCCTCCAAG
AGTGAAAAGAAAAGAAACCAAACCACAACAACCAAACCCCATCCAAAACCCCCAGCTAACCCAAACCCCTCAAGT
TCACCCTCTTCGACCTCGACCGCGATCGCCACCTCGACTACCACGAGCTCCGCGTCGCCTTCCGCGCTCTAGGCT
TCACACTCGGCAAACAAGAGCTCATCTCCCTGCTAACAACGTACGGCGTACCCCGTCCCCAAGTCCAGCAACAAC
AAGGCGCCGCCGGCAACCAACACGCCCAATCCCAACCCCTCGCCTCCAACAAAGGGCCCGTCTCGAACCCGCAAC
ATCCGTCCAATCTGCTCATGCCGCTCTCGTCGTTCCAGGCCGTCACGGCGTTGAAGATCCTCGAGCGGGACCCGC
GCGACGAGATCCTGCGCGCGTTCGAGCTGTTCGATGAGGGCGGCAAGGGGTTCATTGACCTTGAGGATTTGAGGC
GTGTTGCGAGGGAGTTGGGGGAGACTGGGCTTGAGGAGGAGGAGCTTAGAGCTATGATTGAGGAGTTTGATCTTG
AGGGCGTTGGTGGTGTTACTCGGGAGGCTTTTGTTGGGATTTGTTGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail