Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3727.t1
Gene name
Locationscaffold_06:570987..572757
Strand-
Gene length (bp)1770
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 2.1E-66 39 420

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0070279 vitamin B6 binding No
GO:0008152 metabolic process No
GO:0019842 vitamin binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3727.t1
MSATASRPDPFRPAQRVAGQRQDVWSIVNEAAAASPVQPIVNMGQGFFGYNPPKFALDAAKAALDRVECNQYSPT
KGRPRLRQAIADAYSPFFGKKLNPETEVTITTGANEGMLSAFMGFIEDGDEVIIFEPFFDQYISNIEMPGGTIRY
VPLHPPKDGATKTSPASEWTIDFEELERAMNPKTKMIVLNSPHNPVGKVFSREELECIGELCVKYNLIILSDEVY
DRLFYVPYTRIATLSPELFERTLTVCSAGKAFYATGWRVGYLIGPEHLIKYVSGAHTRICYSSVSPLQEAAAVAF
EQAEKEGFWDESRTDMKGKIERFCEVFDELGIPYSDPEGGYFVLANLASVKLPADYPFPPHVASRPRDFKLCWFL
IHEVGVAAIPPTEFYTDANALIAEDYLRFAVCKNDDVLETAKERLRGLKKYITQ*
Coding >Pro_DTO377G3_2|g3727.t1
ATGTCGGCTACAGCTTCGCGACCCGATCCATTTCGCCCCGCCCAGCGGGTGGCAGGACAGCGCCAGGATGTTTGG
TCAATCGTCAACGAAGCCGCCGCAGCTTCGCCAGTTCAGCCGATTGTGAACATGGGCCAGGGATTCTTTGGCTAT
AACCCTCCCAAGTTCGCTCTTGACGCTGCGAAGGCTGCGCTAGACCGAGTGGAATGCAATCAATATTCTCCGACG
AAGGGTCGCCCCCGCCTCAGACAGGCTATTGCGGATGCTTACTCGCCCTTCTTTGGCAAGAAGCTGAACCCCGAG
ACCGAGGTCACGATCACAACCGGCGCAAATGAAGGCATGCTCAGTGCCTTCATGGGCTTCATCGAGGATGGTGAT
GAAGTCATTATCTTCGAGCCCTTTTTTGATCAATATATTAGCAACATTGAGATGCCCGGCGGTACCATCCGCTAT
GTTCCCCTCCACCCGCCCAAGGATGGTGCCACCAAGACCTCTCCTGCATCGGAGTGGACTATCGACTTTGAGGAG
CTCGAAAGGGCCATGAACCCCAAGACAAAGATGATTGTTCTGAACTCTCCACACAACCCCGTCGGCAAGGTCTTC
TCGCGCGAGGAGCTTGAGTGCATTGGTGAACTGTGTGTGAAGTACAACCTTATCATATTGTCTGATGAAGTCTAC
GACCGCCTCTTCTACGTTCCCTACACTAGAATCGCTACCCTGTCCCCAGAGTTGTTCGAGCGCACTTTGACAGTG
TGCTCCGCCGGAAAGGCTTTCTACGCCACTGGTTGGCGTGTTGGGTACCTTATCGGCCCCGAGCACCTGATCAAG
TACGTGTCCGGTGCGCACACCCGTATCTGTTACAGCAGTGTGTCTCCTCTGCAGGAAGCTGCTGCTGTTGCTTTT
GAGCAGGCAGAGAAAGAGGGCTTCTGGGACGAGAGCCGAACAGATATGAAGGGCAAAATTGAGCGGTTCTGCGAG
GTCTTTGATGAGCTTGGTATCCCGTACTCTGATCCCGAGGGTGGATACTTTGTGCTTGCCAACCTGGCCTCTGTA
AAGCTCCCGGCCGACTATCCGTTCCCGCCGCATGTTGCTAGCCGGCCTCGTGATTTCAAGCTCTGCTGGTTCCTC
ATCCATGAGGTTGGCGTGGCTGCTATCCCTCCCACTGAATTCTACACGGATGCCAACGCCCTCATTGCTGAGGAT
TATCTCCGCTTTGCGGTGTGCAAGAACGATGATGTTCTTGAGACTGCCAAGGAGCGCTTGAGGGGACTGAAGAAG
TATATCACCCAGTAA
Transcript >Pro_DTO377G3_2|g3727.t1
ATGTCGGCTACAGCTTCGCGACCCGATCCATTTCGCCCCGCCCAGCGGGTGGCAGGACAGCGCCAGGATGTTTGG
TCAATCGTCAACGAAGCCGCCGCAGCTTCGCCAGTTCAGCCGATTGTGAACATGGGCCAGGGATTCTTTGGCTAT
AACCCTCCCAAGTTCGCTCTTGACGCTGCGAAGGCTGCGCTAGACCGAGTGGAATGCAATCAATATTCTCCGACG
AAGGGTCGCCCCCGCCTCAGACAGGCTATTGCGGATGCTTACTCGCCCTTCTTTGGCAAGAAGCTGAACCCCGAG
ACCGAGGTCACGATCACAACCGGCGCAAATGAAGGCATGCTCAGTGCCTTCATGGGCTTCATCGAGGATGGTGAT
GAAGTCATTATCTTCGAGCCCTTTTTTGATCAATATATTAGCAACATTGAGATGCCCGGCGGTACCATCCGCTAT
GTTCCCCTCCACCCGCCCAAGGATGGTGCCACCAAGACCTCTCCTGCATCGGAGTGGACTATCGACTTTGAGGAG
CTCGAAAGGGCCATGAACCCCAAGACAAAGATGATTGTTCTGAACTCTCCACACAACCCCGTCGGCAAGGTCTTC
TCGCGCGAGGAGCTTGAGTGCATTGGTGAACTGTGTGTGAAGTACAACCTTATCATATTGTCTGATGAAGTCTAC
GACCGCCTCTTCTACGTTCCCTACACTAGAATCGCTACCCTGTCCCCAGAGTTGTTCGAGCGCACTTTGACAGTG
TGCTCCGCCGGAAAGGCTTTCTACGCCACTGGTTGGCGTGTTGGGTACCTTATCGGCCCCGAGCACCTGATCAAG
TACGTGTCCGGTGCGCACACCCGTATCTGTTACAGCAGTGTGTCTCCTCTGCAGGAAGCTGCTGCTGTTGCTTTT
GAGCAGGCAGAGAAAGAGGGCTTCTGGGACGAGAGCCGAACAGATATGAAGGGCAAAATTGAGCGGTTCTGCGAG
GTCTTTGATGAGCTTGGTATCCCGTACTCTGATCCCGAGGGTGGATACTTTGTGCTTGCCAACCTGGCCTCTGTA
AAGCTCCCGGCCGACTATCCGTTCCCGCCGCATGTTGCTAGCCGGCCTCGTGATTTCAAGCTCTGCTGGTTCCTC
ATCCATGAGGTTGGCGTGGCTGCTATCCCTCCCACTGAATTCTACACGGATGCCAACGCCCTCATTGCTGAGGAT
TATCTCCGCTTTGCGGTGTGCAAGAACGATGATGTTCTTGAGACTGCCAAGGAGCGCTTGAGGGGACTGAAGAAG
TATATCACCCAGTAA
Gene >Pro_DTO377G3_2|g3727.t1
ATGTCGGCTACAGCTTCGCGACCCGATCCATTTCGCCCCGCCCAGCGGGTGGCAGGACAGCGCCAGGATGTTTGG
TATGCCGTTTCGGAAAAGAAGTTGGGAAAGACATACTAAACTGAGATCCAAGGTCAATCGTCAACGAAGCCGCCG
CAGCTTCGCCAGTTCAGCCGATTGTGAACATGGGCCAGGGATTCTTGTGAGTCACACCATTTCGAGGACCCCCAA
TTACCCCAAGGGATGGGAATTGACGGGAAATATTTGTGCGCAGTGGCTATAACCCTCCCAAGTTCGCTCTTGACG
CTGCGAAGGCTGCGCTAGACCGAGTGGAATGCAATCAATATTCTCCGACGAAGGTAGAGAACGCCAACGAATCTG
CGCATGGTTACACAGGTGCTCATACATTATAGGGTCGCCCCCGCCTCAGACAGGCTATTGCGGATGCTTACTCGC
CCTTCTTTGGCAAGAAGCTGAACCCCGAGACCGAGGTCACGATCACAACCGGCGCAAATGAAGGTGAGAGATCGG
CATAGTTTATCTATAAATGCATACTTGGCGCTGACAAGCGACGAAATAAAGGCATGCTCAGTGCCTTCATGGGCT
TCATCGAGGATGGTGATGAAGTCATTATCTTCGAGCCCTTTTTTGATCAGTAAGGAGCTCCAACACCGCGAGAGG
ATTGAGCGGATACTAATTTACTCGGAATAGATATATTAGCAACATTGAGATGCCCGGCGGTACCATCCGCTATGT
TCCCCTCCACCCGCCCAAGGATGGTGCCACCAAGACCTCTCCTGCATCGGAGTGGACTATCGACTTTGAGGAGCT
CGAAAGGGCCATGAACCCCAAGACAAAGATGATTGTAAGCATGCGATACCAAGATTCTCATGAATATCCAAGCTA
ATTATAGCAGGTTCTGAACTCTCCGTAAGCAGACCTGATTTACAGAGACGAATGAGGTCTCAACTAACTTTGTAT
TCATAGACACAACCCCGTCGGCAAGGTCTTCTCGCGCGAGGAGCTTGAGTGCATTGGTGAACTGTGTGTGAAGTA
CAACCTTATCATATTGTCTGATGAAGTCTACGACCGCCTCTTCTACGTTCCCTACACTAGAATCGCTACCCTGTC
CCCAGAGTTGTTCGAGCGCACTTTGACAGTGTGCTCCGCCGGAAAGGCTTTCTACGCCACTGGTTGGCGTGTTGG
GTACCTTATCGGCCCCGAGCACCTGATCAAGTACGTGTCCGGTGCGCACACCCGTATCTGTTACAGCAGTGTGTC
TCCTCTGCAGGAAGCTGCTGCTGTTGCTTTTGAGCAGGCAGAGAAAGAGGGCTTCTGGGACGAGAGCCGAACAGA
TATGAAGGGCAAAATTGAGCGGTTCTGCGAGGTCTTTGATGAGCTTGGTATCCCGGTATGTGATTATTCACCCCT
ATGTGCCAAGTCTACTCTCCCATATATTGATTTTGCTGACATCAATCTCTCCAGTACTCTGATCCCGAGGGTGGA
TACTTTGTGCTTGCCAACCTGGCCTCTGTAAAGCTCCCGGCCGACTATCCGTTCCCGCCGCATGTTGCTAGCCGG
CCTCGTGATTTCAAGCTCTGCTGGTTCCTCATCCATGAGGTTGGCGTGGCTGCTATCCCTCCCACTGAATTCTAC
ACGGATGCCAACGCCCTCATTGCTGAGGATTATCTCCGCTTTGCGGTGTGCAAGAACGATGATGTTCTTGAGACT
GCCAAGGAGCGCTTGAGGGGACTGAAGAAGTATATCACCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail