Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3724.t1
Gene name
Locationscaffold_06:557602..561873
Strand+
Gene length (bp)4271
Transcript length (bp)4074
Coding sequence length (bp)4074
Protein length (aa) 1358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02738 Ald_Xan_dh_C2 Molybdopterin-binding domain of aldehyde dehydrogenase 1.8E-201 737 1262
PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase 1.6E-48 266 441
PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain 1.1E-31 450 553
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 6.3E-31 609 718
PF01799 Fer2_2 [2Fe-2S] binding domain 1.6E-28 111 183
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 9.7E-07 34 82

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0009055 electron transfer activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0048037 cofactor binding No
GO:0043167 ion binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3724.t1
MAPGILETESTGAVEKPISLSALTEDWDDTIRFYLNGTKVALDTINPEVTLLEYLRGIGLTGTKLGCAEGGCGAC
TVVVSHINPTTKKIYHASVNACIAPLVSIDGKHVITVEGIGNVKDPHAIQQRIAVGNGSQCGFCTPGIVMSLYAL
LRNNSSPSEHDVEEAFDGNLCRCTGYRPILDAAQSFNSTNNCGKASANGGSGCCMEKNGSGGCCKGSTKNGEIET
VDYKFPAPEFKPYSPDTELIFPVALRKHEYRPLAYGNKKKKWYRPVTVEQLLLIKSVHPDAKLIGGSTETQIEVK
FKAMRYAASVYLGDIPELRQYTLHDNYLEIGANVSLTDLEHICDQAVEKYGDIRGQPFKAIKKQLLYFAGRQIRN
VASPAGNLATASPISDLNPVLVATNTILVAQSLEGETEIPMTEFFQGYRKTALAPNAIIASLRIPAAKAQGEHIR
AYKQSKRKDDDIAIVNSALRVTLSKTNDVVSANLVFGGMAAMTVSAKNAEAFLVGKKFTNPATLEGVMSALEQDF
NLPFGVPGGMASYRKSLALGFFYRFYYDVLSELDVKASDLDPDVVAEIERAISTGAKDLESSVAYQQKILGRATP
HVAALKQSTGEAQYTDDIPVQQNELFACMVLSTKPHAKILSVDPSAALDIPGVADYINHTDLPNPKANWWGQPKS
DELFFAVDEVFTAGQPIGAILATSAKIAEEGMRAVKVEYEDLPSILTMEEAIEAKSFFDHYRSIKNGDTEEAFRK
ADHVFTGVSRMGGQEHFYLETQACVAIPKPEDGEMEIWSGTQNPNETQAYVAQVTGVSANKVVSRVKRLGGGFGG
KESRSIQLAGICAIGAAKTRRPVRCMLNRDEDILTSGQRHPFLCHWKVGVTKEGKLLALDADVYANGGHTQDLSG
AVVERSLSHIDNVYKIPNVNVRGWVCKTNTVSNTAFRGFGGPQGLFFAECYISEIADRLDIPAEEIRAINMYKAG
EMTHFNQPLKDWHVPLMYKQVLEESSYKERRKAVEEYNAQHKWSKRGMAIVPTKFGISFTALFLNQAGALVHIYH
DGSVLVAHGGVEMGQGLHTKMTMIAAEALQVPQSNVFISETATNTVANASSTAASASSDLNGYAIFNACEELNKR
LRPFREKMPNATMKELAHAAYFDRVNLSAQGYYRTPDIGYVWGENSGQMFFYFTQGVTASEVQIDTLTGDWTPLR
SDIKMDVGRSINPSVDYGQIEGAYVQGQGLFTTEESLWHRASGQIFTRGPGNYKIPGFRDIPQVFNVSLLKDVEW
ENLRTIQRSRGVGEPPLFMGSAVFFAIRDALKAARKQWNVTDVLSLESPATPERIRVSCADPIIERVRVHPKEGE
KSFFVAI*
Coding >Pro_DTO377G3_2|g3724.t1
ATGGCGCCGGGAATCCTGGAGACGGAGTCCACGGGCGCAGTCGAGAAGCCCATCAGCCTGTCTGCGTTGACTGAG
GACTGGGATGACACTATTCGGTTCTATCTCAACGGCACCAAGGTTGCACTAGACACGATAAACCCGGAAGTGACT
CTACTCGAATACTTGCGGGGTATTGGGTTGACAGGCACGAAGCTCGGATGTGCCGAGGGAGGCTGTGGTGCTTGC
ACTGTGGTCGTCTCCCATATCAATCCGACAACGAAGAAAATCTACCATGCCTCCGTGAATGCCTGTATCGCTCCA
CTCGTTAGCATTGATGGTAAGCACGTTATCACAGTCGAAGGGATTGGGAATGTGAAAGATCCCCACGCCATCCAG
CAGCGGATTGCGGTCGGCAATGGAAGTCAATGTGGTTTCTGTACTCCTGGAATAGTCATGTCTCTTTATGCTTTG
CTACGAAACAATTCATCTCCCTCGGAACACGATGTTGAAGAAGCCTTCGATGGAAACCTTTGCCGCTGCACGGGT
TACAGACCTATTCTGGATGCTGCCCAGAGCTTCAACTCGACCAACAACTGCGGAAAAGCCTCTGCGAATGGTGGT
TCGGGCTGCTGTATGGAGAAAAATGGATCCGGTGGCTGCTGCAAAGGGTCCACCAAGAATGGCGAGATTGAGACT
GTCGATTACAAGTTCCCTGCGCCAGAATTCAAGCCGTACAGTCCAGACACAGAGTTGATCTTCCCTGTCGCCCTG
CGGAAACACGAATACCGACCCTTGGCATATGGCAACAAGAAGAAGAAGTGGTACCGACCGGTGACCGTCGAGCAA
TTGTTGCTGATCAAGAGCGTCCACCCAGATGCTAAACTAATTGGCGGAAGCACGGAGACACAGATTGAGGTTAAG
TTCAAGGCAATGCGATACGCGGCCTCCGTCTACCTGGGAGATATCCCCGAATTGCGACAATATACCTTGCACGAC
AACTATCTGGAGATCGGCGCAAATGTGTCTTTAACAGACCTCGAACACATCTGTGACCAAGCGGTAGAAAAGTAC
GGCGATATCAGAGGCCAACCTTTCAAAGCAATCAAGAAGCAGTTGCTCTATTTCGCTGGGCGACAGATCCGAAAC
GTCGCTTCCCCGGCGGGTAACCTGGCCACTGCATCGCCCATCTCTGATCTTAATCCGGTTTTGGTAGCCACTAAC
ACTATCCTCGTGGCCCAATCCCTCGAAGGAGAGACTGAAATTCCAATGACCGAATTCTTCCAAGGATACAGAAAG
ACTGCCCTCGCTCCCAACGCGATCATTGCTAGCTTGCGCATTCCAGCCGCGAAGGCTCAGGGAGAGCACATTCGA
GCCTACAAGCAATCTAAGCGGAAGGACGATGATATTGCCATTGTCAACTCCGCCTTACGCGTGACTCTTTCTAAG
ACCAATGATGTGGTCAGCGCCAATCTTGTGTTTGGTGGCATGGCAGCTATGACCGTCTCAGCAAAGAATGCCGAG
GCGTTTTTGGTTGGCAAGAAGTTCACGAACCCCGCAACTCTAGAGGGTGTCATGAGCGCACTGGAGCAGGATTTC
AACCTGCCATTTGGAGTTCCTGGTGGTATGGCTAGTTATCGGAAGTCTTTGGCTCTGGGATTCTTCTACAGATTT
TACTACGACGTACTTTCAGAACTCGATGTCAAGGCTTCGGATTTAGATCCAGATGTTGTTGCTGAGATTGAAAGA
GCAATTTCTACAGGAGCTAAAGACCTTGAAAGCTCTGTCGCCTACCAACAGAAGATTCTTGGACGAGCGACTCCG
CATGTTGCGGCGTTGAAGCAGTCCACCGGAGAGGCTCAATACACAGATGACATTCCTGTGCAACAGAATGAGTTA
TTCGCGTGCATGGTTCTGTCCACCAAGCCTCATGCCAAAATCCTTAGCGTTGACCCGTCCGCTGCATTGGACATT
CCAGGTGTTGCAGACTACATTAACCACACGGATCTTCCGAATCCCAAAGCAAATTGGTGGGGACAACCCAAGTCC
GATGAGCTTTTCTTTGCCGTCGATGAAGTTTTTACTGCTGGTCAACCGATTGGTGCCATTCTAGCGACCAGTGCC
AAAATCGCCGAGGAAGGTATGAGGGCTGTCAAGGTCGAATATGAAGACCTCCCGAGTATCCTTACGATGGAGGAG
GCCATTGAGGCGAAGTCTTTCTTTGACCACTATCGCTCGATCAAAAATGGTGATACCGAGGAAGCGTTCAGAAAA
GCTGACCACGTCTTTACTGGAGTCTCGCGAATGGGTGGCCAGGAGCACTTCTACCTGGAAACCCAAGCATGTGTG
GCGATTCCAAAGCCGGAGGATGGTGAAATGGAGATTTGGAGTGGTACCCAGAATCCCAACGAAACACAAGCCTAT
GTCGCTCAGGTGACAGGAGTATCTGCGAACAAAGTTGTATCGCGCGTGAAGCGACTTGGTGGTGGCTTTGGAGGC
AAGGAGTCTCGATCTATCCAGCTGGCTGGTATTTGTGCCATTGGCGCTGCGAAAACAAGACGGCCCGTGCGATGT
ATGCTCAACCGTGATGAAGATATTTTGACTTCTGGTCAGCGGCACCCGTTCCTCTGCCATTGGAAGGTTGGTGTG
ACGAAAGAAGGAAAACTCCTTGCTCTTGATGCAGATGTATACGCCAATGGCGGTCATACGCAAGATCTATCCGGT
GCTGTCGTGGAGCGAAGCTTGTCACACATTGATAACGTTTATAAAATACCGAATGTCAATGTGCGCGGCTGGGTC
TGCAAAACCAATACAGTATCAAACACAGCTTTCCGTGGTTTCGGCGGCCCACAAGGCTTGTTCTTTGCCGAGTGT
TATATATCGGAGATTGCAGATCGTCTGGATATTCCGGCCGAAGAGATTCGGGCCATCAATATGTACAAGGCAGGT
GAGATGACGCATTTCAACCAGCCTCTCAAAGATTGGCACGTGCCTTTGATGTACAAGCAAGTGCTAGAGGAGAGC
TCTTACAAGGAGCGTCGGAAGGCTGTCGAGGAATACAACGCGCAGCACAAGTGGTCCAAACGCGGAATGGCGATT
GTGCCAACCAAGTTCGGTATTTCTTTCACAGCTCTCTTCTTGAACCAAGCAGGAGCTTTGGTTCACATCTACCAC
GACGGCAGTGTCCTCGTAGCACACGGTGGTGTTGAAATGGGACAAGGCCTTCACACAAAGATGACCATGATTGCC
GCCGAAGCACTGCAAGTGCCGCAGTCGAACGTCTTCATTTCGGAAACAGCGACCAACACAGTGGCCAATGCCTCC
TCAACGGCCGCCTCGGCAAGCTCCGATCTCAACGGCTACGCGATTTTCAATGCCTGTGAAGAATTAAACAAACGC
CTACGTCCCTTCCGCGAGAAGATGCCCAACGCCACCATGAAAGAACTAGCCCACGCAGCCTACTTCGACCGTGTC
AACCTCTCCGCACAAGGCTACTACCGCACCCCGGATATCGGCTACGTATGGGGCGAGAACAGCGGCCAGATGTTC
TTCTACTTCACGCAAGGAGTCACGGCATCCGAAGTCCAAATCGACACACTGACCGGTGACTGGACGCCTCTACGC
TCCGACATAAAGATGGACGTAGGTCGCAGCATCAACCCCTCAGTGGACTACGGCCAGATCGAAGGCGCCTATGTC
CAAGGACAAGGTCTCTTCACCACCGAAGAGAGTCTCTGGCACCGAGCCTCGGGCCAGATATTCACCAGAGGCCCG
GGAAACTACAAGATCCCCGGCTTCCGTGATATCCCGCAGGTCTTCAATGTCAGTTTGCTTAAGGATGTGGAGTGG
GAGAACTTGCGCACGATTCAACGCTCGCGGGGTGTCGGCGAGCCGCCCTTGTTTATGGGTAGTGCGGTCTTCTTT
GCTATTCGTGACGCTTTGAAGGCGGCGCGTAAGCAGTGGAACGTCACTGACGTGCTCTCTTTGGAGTCCCCTGCC
ACCCCCGAGCGGATTCGGGTTAGTTGTGCGGATCCGATCATCGAGCGCGTGAGAGTGCATCCTAAGGAGGGGGAA
AAGAGTTTCTTTGTTGCCATATAG
Transcript >Pro_DTO377G3_2|g3724.t1
ATGGCGCCGGGAATCCTGGAGACGGAGTCCACGGGCGCAGTCGAGAAGCCCATCAGCCTGTCTGCGTTGACTGAG
GACTGGGATGACACTATTCGGTTCTATCTCAACGGCACCAAGGTTGCACTAGACACGATAAACCCGGAAGTGACT
CTACTCGAATACTTGCGGGGTATTGGGTTGACAGGCACGAAGCTCGGATGTGCCGAGGGAGGCTGTGGTGCTTGC
ACTGTGGTCGTCTCCCATATCAATCCGACAACGAAGAAAATCTACCATGCCTCCGTGAATGCCTGTATCGCTCCA
CTCGTTAGCATTGATGGTAAGCACGTTATCACAGTCGAAGGGATTGGGAATGTGAAAGATCCCCACGCCATCCAG
CAGCGGATTGCGGTCGGCAATGGAAGTCAATGTGGTTTCTGTACTCCTGGAATAGTCATGTCTCTTTATGCTTTG
CTACGAAACAATTCATCTCCCTCGGAACACGATGTTGAAGAAGCCTTCGATGGAAACCTTTGCCGCTGCACGGGT
TACAGACCTATTCTGGATGCTGCCCAGAGCTTCAACTCGACCAACAACTGCGGAAAAGCCTCTGCGAATGGTGGT
TCGGGCTGCTGTATGGAGAAAAATGGATCCGGTGGCTGCTGCAAAGGGTCCACCAAGAATGGCGAGATTGAGACT
GTCGATTACAAGTTCCCTGCGCCAGAATTCAAGCCGTACAGTCCAGACACAGAGTTGATCTTCCCTGTCGCCCTG
CGGAAACACGAATACCGACCCTTGGCATATGGCAACAAGAAGAAGAAGTGGTACCGACCGGTGACCGTCGAGCAA
TTGTTGCTGATCAAGAGCGTCCACCCAGATGCTAAACTAATTGGCGGAAGCACGGAGACACAGATTGAGGTTAAG
TTCAAGGCAATGCGATACGCGGCCTCCGTCTACCTGGGAGATATCCCCGAATTGCGACAATATACCTTGCACGAC
AACTATCTGGAGATCGGCGCAAATGTGTCTTTAACAGACCTCGAACACATCTGTGACCAAGCGGTAGAAAAGTAC
GGCGATATCAGAGGCCAACCTTTCAAAGCAATCAAGAAGCAGTTGCTCTATTTCGCTGGGCGACAGATCCGAAAC
GTCGCTTCCCCGGCGGGTAACCTGGCCACTGCATCGCCCATCTCTGATCTTAATCCGGTTTTGGTAGCCACTAAC
ACTATCCTCGTGGCCCAATCCCTCGAAGGAGAGACTGAAATTCCAATGACCGAATTCTTCCAAGGATACAGAAAG
ACTGCCCTCGCTCCCAACGCGATCATTGCTAGCTTGCGCATTCCAGCCGCGAAGGCTCAGGGAGAGCACATTCGA
GCCTACAAGCAATCTAAGCGGAAGGACGATGATATTGCCATTGTCAACTCCGCCTTACGCGTGACTCTTTCTAAG
ACCAATGATGTGGTCAGCGCCAATCTTGTGTTTGGTGGCATGGCAGCTATGACCGTCTCAGCAAAGAATGCCGAG
GCGTTTTTGGTTGGCAAGAAGTTCACGAACCCCGCAACTCTAGAGGGTGTCATGAGCGCACTGGAGCAGGATTTC
AACCTGCCATTTGGAGTTCCTGGTGGTATGGCTAGTTATCGGAAGTCTTTGGCTCTGGGATTCTTCTACAGATTT
TACTACGACGTACTTTCAGAACTCGATGTCAAGGCTTCGGATTTAGATCCAGATGTTGTTGCTGAGATTGAAAGA
GCAATTTCTACAGGAGCTAAAGACCTTGAAAGCTCTGTCGCCTACCAACAGAAGATTCTTGGACGAGCGACTCCG
CATGTTGCGGCGTTGAAGCAGTCCACCGGAGAGGCTCAATACACAGATGACATTCCTGTGCAACAGAATGAGTTA
TTCGCGTGCATGGTTCTGTCCACCAAGCCTCATGCCAAAATCCTTAGCGTTGACCCGTCCGCTGCATTGGACATT
CCAGGTGTTGCAGACTACATTAACCACACGGATCTTCCGAATCCCAAAGCAAATTGGTGGGGACAACCCAAGTCC
GATGAGCTTTTCTTTGCCGTCGATGAAGTTTTTACTGCTGGTCAACCGATTGGTGCCATTCTAGCGACCAGTGCC
AAAATCGCCGAGGAAGGTATGAGGGCTGTCAAGGTCGAATATGAAGACCTCCCGAGTATCCTTACGATGGAGGAG
GCCATTGAGGCGAAGTCTTTCTTTGACCACTATCGCTCGATCAAAAATGGTGATACCGAGGAAGCGTTCAGAAAA
GCTGACCACGTCTTTACTGGAGTCTCGCGAATGGGTGGCCAGGAGCACTTCTACCTGGAAACCCAAGCATGTGTG
GCGATTCCAAAGCCGGAGGATGGTGAAATGGAGATTTGGAGTGGTACCCAGAATCCCAACGAAACACAAGCCTAT
GTCGCTCAGGTGACAGGAGTATCTGCGAACAAAGTTGTATCGCGCGTGAAGCGACTTGGTGGTGGCTTTGGAGGC
AAGGAGTCTCGATCTATCCAGCTGGCTGGTATTTGTGCCATTGGCGCTGCGAAAACAAGACGGCCCGTGCGATGT
ATGCTCAACCGTGATGAAGATATTTTGACTTCTGGTCAGCGGCACCCGTTCCTCTGCCATTGGAAGGTTGGTGTG
ACGAAAGAAGGAAAACTCCTTGCTCTTGATGCAGATGTATACGCCAATGGCGGTCATACGCAAGATCTATCCGGT
GCTGTCGTGGAGCGAAGCTTGTCACACATTGATAACGTTTATAAAATACCGAATGTCAATGTGCGCGGCTGGGTC
TGCAAAACCAATACAGTATCAAACACAGCTTTCCGTGGTTTCGGCGGCCCACAAGGCTTGTTCTTTGCCGAGTGT
TATATATCGGAGATTGCAGATCGTCTGGATATTCCGGCCGAAGAGATTCGGGCCATCAATATGTACAAGGCAGGT
GAGATGACGCATTTCAACCAGCCTCTCAAAGATTGGCACGTGCCTTTGATGTACAAGCAAGTGCTAGAGGAGAGC
TCTTACAAGGAGCGTCGGAAGGCTGTCGAGGAATACAACGCGCAGCACAAGTGGTCCAAACGCGGAATGGCGATT
GTGCCAACCAAGTTCGGTATTTCTTTCACAGCTCTCTTCTTGAACCAAGCAGGAGCTTTGGTTCACATCTACCAC
GACGGCAGTGTCCTCGTAGCACACGGTGGTGTTGAAATGGGACAAGGCCTTCACACAAAGATGACCATGATTGCC
GCCGAAGCACTGCAAGTGCCGCAGTCGAACGTCTTCATTTCGGAAACAGCGACCAACACAGTGGCCAATGCCTCC
TCAACGGCCGCCTCGGCAAGCTCCGATCTCAACGGCTACGCGATTTTCAATGCCTGTGAAGAATTAAACAAACGC
CTACGTCCCTTCCGCGAGAAGATGCCCAACGCCACCATGAAAGAACTAGCCCACGCAGCCTACTTCGACCGTGTC
AACCTCTCCGCACAAGGCTACTACCGCACCCCGGATATCGGCTACGTATGGGGCGAGAACAGCGGCCAGATGTTC
TTCTACTTCACGCAAGGAGTCACGGCATCCGAAGTCCAAATCGACACACTGACCGGTGACTGGACGCCTCTACGC
TCCGACATAAAGATGGACGTAGGTCGCAGCATCAACCCCTCAGTGGACTACGGCCAGATCGAAGGCGCCTATGTC
CAAGGACAAGGTCTCTTCACCACCGAAGAGAGTCTCTGGCACCGAGCCTCGGGCCAGATATTCACCAGAGGCCCG
GGAAACTACAAGATCCCCGGCTTCCGTGATATCCCGCAGGTCTTCAATGTCAGTTTGCTTAAGGATGTGGAGTGG
GAGAACTTGCGCACGATTCAACGCTCGCGGGGTGTCGGCGAGCCGCCCTTGTTTATGGGTAGTGCGGTCTTCTTT
GCTATTCGTGACGCTTTGAAGGCGGCGCGTAAGCAGTGGAACGTCACTGACGTGCTCTCTTTGGAGTCCCCTGCC
ACCCCCGAGCGGATTCGGGTTAGTTGTGCGGATCCGATCATCGAGCGCGTGAGAGTGCATCCTAAGGAGGGGGAA
AAGAGTTTCTTTGTTGCCATATAG
Gene >Pro_DTO377G3_2|g3724.t1
ATGGCGCCGGGAATCCTGGAGACGGAGTCCACGGGCGCAGTCGAGAAGCCCATCAGCCTGTCTGCGTTGACTGAG
GACTGGGATGACACTATTCGGTTCTATCTCAACGGCACCAAGGTTGCACTAGACACGATAAACCCGGAAGTGACT
CTACTCGAATACTTGCGGGGTATTGGGTTGACAGGCACGAAGCTCGGATGTGCCGAGGGAGGCTGTGGTGCTTGC
ACTGTGGTGGGTTTCAGTCAACTATCTCGGGTTATGCATATACATAGTGCTAACTAGAGCGTTATACCGTCAATA
GGTCGTCTCCCATATCAATCCGACAACGAAGAAAATCTACCATGCCTCCGTGAATGCCTGTATCGCTCCACTCGT
TAGCATTGATGGTAAGCACGTTATCACAGTCGAAGGGATTGGGAATGTGAAAGATCCCCACGCCATCCAGCAGCG
GATTGCGGTCGGCAATGGAAGTCAATGTGGTTTCTGTACTCCTGGAATAGTCATGGTACGCCTTTATGCTCTTTT
CGCTGGCTTCCATTTTTGAAGGGATCCGAGGTTGACTAATAATTTCAAGTCTCTTTATGCTTTGCTACGAAACAA
TTCATCTCCCTCGGAACACGATGTTGAAGAAGCCTTCGATGGAAACCTTTGCCGCTGCACGGGTTACAGACCTAT
TCTGGATGCTGCCCAGAGCTTCAACTCGACCAACAACTGCGGAAAAGCCTCTGCGAATGGTGGTTCGGGCTGCTG
TATGGAGAAAAATGGATCCGGTGGCTGCTGCAAAGGGTCCACCAAGAATGGCGAGATTGAGACTGTCGATTACAA
GTTCCCTGCGCCAGAATTCAAGCCGTACAGTCCAGACACAGAGTTGATCTTCCCTGTCGCCCTGCGGAAACACGA
ATACCGACCCTTGGCATATGGCAACAAGAAGAAGAAGTGGTACCGACCGGTGACCGTCGAGCAATTGTTGCTGAT
CAAGAGCGTCCACCCAGATGCTAAACTAATTGGCGGAAGCACGGAGACACAGATTGAGGTTAAGTTCAAGGCAAT
GCGATACGCGGCCTCCGTCTACCTGGGAGATATCCCCGAATTGCGACAATATACCTTGCACGACAACTATCTGGA
GATCGGCGCAAATGTGTCTTTAACAGACCTCGAACACATCTGTGACCAAGCGGTAGAAAAGTACGGCGATATCAG
AGGCCAACCTTTCAAAGCAATCAAGAAGCAGTTGCTCTATTTCGCTGGGCGACAGATCCGAAACGTCGCTTCCCC
GGCGGGTAACCTGGCCACTGCATCGCCCATCTCTGATCTTAATCCGGTTTTGGTAGCCACTAACACTATCCTCGT
GGCCCAATCCCTCGAAGGAGAGACTGAAATTCCAATGACCGAATTCTTCCAAGGATACAGAAAGACTGCCCTCGC
TCCCAACGCGATCATTGCTAGCTTGCGCATTCCAGCCGCGAAGGCTCAGGGAGAGCACATTCGAGCCTACAAGCA
ATCTAAGCGGAAGGACGATGATATTGCCATTGTCAACTCCGCCTTACGCGTGACTCTTTCTAAGACCAATGATGT
GGTCAGCGCCAATCTTGTGTTTGGTGGCATGGCAGCTATGACCGTCTCAGCAAAGAATGCCGAGGCGTTTTTGGT
TGGCAAGAAGTTCACGAACCCCGCAACTCTAGAGGGTGTCATGAGCGCACTGGAGCAGGATTTCAACCTGCCATT
TGGAGTTCCTGGTGGTATGGCTAGTTATCGGAAGTCTTTGGCTCTGGGATTCTTCTACAGATTTTACTACGACGT
ACTTTCAGAACTCGATGTCAAGGCTTCGGATTTAGATCCAGATGTTGTTGCTGAGATTGAAAGAGCAATTTCTAC
AGGAGCTAAAGACCTTGAAAGCTCTGTCGCCTACCAACAGAAGATTCTTGGACGAGCGACTCCGCATGTTGCGGC
GTTGAAGCAGTCCACCGGAGAGGCTCAATACACAGATGACATTCCTGTGCAACAGAATGAGTTATTCGCGTGCAT
GGTTCTGTCCACCAAGCCTCATGCCAAAATCCTTAGCGTTGACCCGTCCGCTGCATTGGACATTCCAGGTGTTGC
AGACTACATTAACCACACGGATCTTCCGAATCCCAAAGCAAATTGGTGGGGACAACCCAAGTCCGATGAGCTTTT
CTTTGCCGTCGATGAAGTTTTTACTGCTGGTCAACCGATTGGTGCCATTCTAGCGACCAGTGCCAAAATCGCCGA
GGAAGGTATGAGGGCTGTCAAGGTCGAATATGAAGACCTCCCGAGTATCCTTACGATGGAGGAGGCCATTGAGGC
GAAGTCTTTCTTTGACCACTATCGCTCGATCAAAAATGGTGATACCGAGGAAGCGTTCAGAAAAGCTGACCACGT
CTTTACTGGAGTCTCGCGAATGGGTGGCCAGGAGCACTTCTACCTGGAAACCCAAGCATGTGTGGCGATTCCAAA
GCCGGAGGATGGTGAAATGGAGATTTGGAGTGGTACCCAGAATCCCAACGAAACGTGAGTAGCGATATATTTGAC
TCTGTCTTATAACAGAATTTAAGCTAAGCGTGTACAGACAAGCCTATGTCGCTCAGGTGACAGGAGTATCTGCGA
ACAAAGTTGTATCGCGCGTGAAGCGACTTGGTGGTGGCTTTGGAGGCAAGGAGTCTCGATCTATCCAGCTGGCTG
GTATTTGTGCCATTGGCGCTGCGAAAACAAGACGGCCCGTGCGATGTATGCTCAACCGTGATGAAGATATTTTGA
CTTCTGGTCAGCGGCACCCGTTCCTCTGCCATTGGAAGGTTGGTGTGACGAAAGAAGGAAAACTCCTTGCTCTTG
ATGCAGATGTATACGCCAATGGCGGTCATACGCAAGATCTATCCGGTGCTGTCGTGGAGCGAAGCTTGTCACACA
TTGATAACGTTTATAAAATACCGAATGTCAATGTGCGCGGCTGGGTCTGCAAAACCAATACAGTATCAAACACAG
CTTTCCGTGGTTTCGGCGGCCCACAAGGCTTGTTCTTTGCCGAGTGTTATATATCGGAGATTGCAGATCGTCTGG
ATATTCCGGCCGAAGAGATTCGGGCCATCAATATGTACAAGGCAGGTGAGATGACGCATTTCAACCAGCCTCTCA
AAGATTGGCACGTGCCTTTGATGTACAAGCAAGTGCTAGAGGAGAGCTCTTACAAGGAGCGTCGGAAGGCTGTCG
AGGAATACAACGCGCAGCACAAGTGGTCCAAACGCGGAATGGCGATTGTGCCAACCAAGTTCGGTATTTCTTTCA
CAGCTCTCTTCTTGAACCAAGCAGGAGCTTTGGTTCACATCTACCACGACGGCAGTGTCCTCGTAGCACACGGTG
GTGTTGAAATGGGACAAGGCCTTCACACAAAGATGACCATGATTGCCGCCGAAGCACTGCAAGTGCCGCAGTCGA
ACGTCTTCATTTCGGAAACAGCGACCAACACAGTGGCCAATGCCTCCTCAACGGCCGCCTCGGCAAGCTCCGATC
TCAACGGCTACGCGATTTTCAATGCCTGTGAAGAATTAAACAAACGCCTACGTCCCTTCCGCGAGAAGATGCCCA
ACGCCACCATGAAAGAACTAGCCCACGCAGCCTACTTCGACCGTGTCAACCTCTCCGCACAAGGCTACTACCGCA
CCCCGGATATCGGCTACGTATGGGGCGAGAACAGCGGCCAGATGTTCTTCTACTTCACGCAAGGAGTCACGGCAT
CCGAAGTCCAAATCGACACACTGACCGGTGACTGGACGCCTCTACGCTCCGACATAAAGATGGACGTAGGTCGCA
GCATCAACCCCTCAGTGGACTACGGCCAGATCGAAGGCGCCTATGTCCAAGGACAAGGTCTCTTCACCACCGAAG
AGAGTCTCTGGCACCGAGCCTCGGGCCAGATATTCACCAGAGGCCCGGGAAACTACAAGATCCCCGGCTTCCGTG
ATATCCCGCAGGTCTTCAATGTCAGTTTGCTTAAGGATGTGGAGTGGGAGAACTTGCGCACGATTCAACGCTCGC
GGGGTGTCGGCGAGCCGCCCTTGTTTATGGGTAGTGCGGTCTTCTTTGCTATTCGTGACGCTTTGAAGGCGGCGC
GTAAGCAGTGGAACGTCACTGACGTGCTCTCTTTGGAGTCCCCTGCCACCCCCGAGCGGATTCGGGTTAGTTGTG
CGGATCCGATCATCGAGCGCGTGAGAGTGCATCCTAAGGAGGGGGAAAAGAGTTTCTTTGTTGCCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail