Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3697.t1
Gene name
Locationscaffold_06:470010..479604
Strand+
Gene length (bp)9594
Transcript length (bp)9480
Coding sequence length (bp)9480
Protein length (aa) 3160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 1.5E-94 2225 2505
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 3.0E-89 591 826
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 3.5E-75 139 376
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 2.1E-68 2755 2931
PF12624 Chorein_N N-terminal region of Chorein or VPS13 6.6E-39 2 114

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3697.t1
MLEGVVANLLNRFLGIYVKNFDATQLNIGIWSGDVKLRNLELRREALDQLRLPLNVVEGHLGELTLSIPWSNLRG
KPVKVDIQDVFLLAAPREDADFDPEEEAKRENALKMERVESAEILRERNAEGMSQEEQRRNQSFTQSMITAVVDN
LQISIKNVHFRYEDSIASPGHPFAVGVTLKELSAVSTDGEWNPTFIQSDSSVTHKLAVLGALSAYWNTDAKLLGT
GRGSDIGAEAQGISRADLIEKLRTAIDADEGNQFMLRPVSGRAGLEMDKSGTYERPAIKARLLFDELGFVLDEKQ
YRDALMLVDLFHYFIRHQEHKKIQPKASPKEDPRAWMRFAGEAVLSKIHERNRRWTWDYIKERRDDRIAYIALFK
KTKKEEAFTPEETKELQRLEAKLSYEDIRFWRSLARNQLRKENVGVKKPAEQQSWSAWLWGAKKEESEETAMTEE
QRQELYNAIDWDEKKAITESVDVPREWVKLQVNWSLRAGSFTLIQDPHGSANEVMKLVFDNFRAKALQRHDSYLL
DLDLGGLKMYDGTTAGTLYPQIVKVKDSPPESTKVEELSEDDDELASQTSADDLQDEDSLFHLQLEKNPLDSDAD
TAVKVKLKSIEVIYNPRFLVGIVKFFEPPERHMESIGALLDTAGATVEGLRQQTRAGLEFALQEHKKVDAQFDIH
APLIIVPESITQPSSLCLIIDAGHASVNSELVDRKAMREIQSKQKKQYAEDDYKQLEHLMYDRFLIKLDSTQVLI
GPGVDATKAQLNTNVESRNFHIIDRINVDFALEMCIVPSVTQLTRTRISGHLPELHASISDTKYKGLMKLIDIAI
PEFDTEKSASDSVTAAAKEEAALATRDRSSSFQPAVQRDLPVVDDDEDEVDSEHAKKRVDTPANIHRRDFEFKFT
VGRLRGSLSRSDPHDPQRDQLLVELVAEGFELDFYMRPYDMVAEVILKSLSVDDHIEENPVPEFKRIISSKGFDA
DEDKDLFQLKMVRVKPESPEFDSTYEGVAMNLDISVSTINLVVTRKTLLTLLDFTLLTFTNPQQPTQPNPETDKA
IEGTASVEEKPEQAGKIRIKANLKSIALILNNDGVRLATLSLNTADVGVFLVGSSMLIQSRIGSLTLVDDVNLGA
AEDSDIRRLLTIEGDDFADFKYETFDPDSETHPGYDSEVYLRSGSIKINFLEEPYRKIIHFLVKFGKMQAIFNAA
RQAAASQANQLQENASRVRLDIIVKTPIVVFPRVMTDGRPRDTITAHLGEIYAKNEFVPMDDGKDSPAVNVISTG
VRNIRLTSNFHFEDGTSEELEMIQKVNLEFSICYLEHQANNPRPDMEIEGSLSPINLRISQSQLKFLLELSKSIP
NAFATDTEQQELEAMESLPSSVTEPTREASSKAVQAQNGSGGAFPDDENRETWVRLDMIFKVDSVGLELILANDD
QPVGRLEDSSLSKFSLNDTRVKLRMLTDGSLESELLIHSFSIRDSRKQDSNKFRNIMSLINNDVQQQFMASVSMS
GGPEKHLIAMLTIDSPRIMFALDYLSALQSFSQSAFASEGPIEVQDESESPEESESGSDTIVSSNKAITEASSGD
ATAAAMTVSFRVNLVDAQVIMVANPAIPHSEAIVLGTKEVLISHQNVSTLQIQKVGMFLCRMDKFETSRLRILDD
FTLEMSIDSRSQDKGSALTSIEVHLEPLVLRLSLRDILMAIQIVNKASEMTQNAQQTESGEAKKITDTKTTRGRS
SSKTSSAVVKRSNRPSQGAGNLDRTTAPQSSVVLKREEMSAKIDGVRVILIGDLHDLPLVDWSVKKFNIDVRDWS
STLNADTNFETFMNVYNFSKSAWEPLIEPWQLGFHMAKETNPDVFSFDVYSHKTMELTITSATIALASKSFQFLS
TDQDVLAKPRGADAPYRIRNYTGFDLSVWADVSEGVEGPAAKLTDGEEAPWRFEDSTAIRESLTPEGHGGVVGVK
LEGSGFDSISRIPVVREGEVIYALKPKQQSVLHRLLVEVKLGPDNVKYITFRSPLLIENNTQIPVEMGIFSPGEG
HLLKIEKILPGDARPAPVGSAYLHSIVVRPDQGFGYDWSDERLFWKDLIKRPTRTVKCISENGQQAPPFYFQVNA
TFDSKDSLTSVYPYMRIRIFAPVEIQNLLPYDFKYRIYDKNTKKDWTNFLRKGGVSPVHVVELSHLLLLSIDLQD
SVFRQSEFAIVNGNAQDYRREHTLTLKDERGLQLRLQLHYFNIPNSGGAFKVSVYSPYLVLNKTGLPMDIQSKAF
LQSARNAAGQGLRADPRDEGRALPYMYSYANEDQSNRSILKVSDSAWSKPQSFEAIGSTFEVIFPDRQGRSEFHS
GVSVAEGEGKYKMTKVVTLAPRFILKSKLNEDLLAREPGSSNVLQVKNGQLVPLHFLRQVQEKQLCLCFPGVNNQ
WSSPFNIADVGTVHVKLAKANQRQKLIKIDIIMEGATLFLHFSLEQRNWPFSMRNESDMEFIFYQANPNVEDDDE
EDQTSGWRPIRYRIPARSIMPYAWDYPATKNKSLVLTCQGKERHIKLAEIGNLIPMRIPASQPGEHQKIIDINIA
ADGPTQTLVLSNFKPSKSMYKQQSRQSSQVGSTAGFEIKEMNSDVNFKAQLRLGGIGISLINQNLKELLYLTFRE
IEFKFRESRLYQTLNATIKWIQIDNQLYGGIFPILLYPSVVPKTGKEMEAHPIFHAMVTRVKDDSYGVLYIKYAT
LLLQQMTLELDEDFVLAMLDFVKIPGASWAEEQEGKLCDEDLNIPEPRQEDNGQDVYFELLHLQPMQMDISFMRT
ERVNVEDTMQPSNPLMFFVNVMTMSMGNVNDAPVRLNALMLENARVSFPSLVANIRAHYTQEFLGQIHIILGSAD
FLGNPVGLFNNVSSGVAAIFYEPYQGLVMTDRPQELGLGIAKGATSFMKKSIFGFSDSMAKLTGSMSKGLAAATL
DKEFQNQRRMSKVRNRPKHALYGITAGGSAFATSLASGIGGLARHPLQGAEKEGIQGFFKGVGKGVLGLATKPAI
GAFDLASNLAEGVRNTTTVFDAEGLDRVRLTRFIGTDGIVRPYSQREALGQFWLKTTDDGKYFDEDYIAHLELPG
RDMLVLLTYARIMLVRTKKLYTEWDIRLTDIQTISKERTGMSITLKGGANGPFIPVQDESSRNWLYRQIAVAVNA
FNEKYNSRG*
Coding >Pro_DTO377G3_2|g3697.t1
ATGTTGGAGGGAGTAGTAGCGAACCTACTGAATCGGTTCCTGGGAATTTACGTCAAGAACTTCGATGCGACCCAG
CTCAACATCGGAATCTGGTCAGGCGACGTCAAGCTACGGAACCTTGAACTACGCCGCGAAGCGCTCGATCAGCTA
CGCCTCCCTCTAAACGTCGTCGAAGGCCATCTCGGAGAGCTTACACTATCAATCCCATGGTCAAACCTACGAGGC
AAACCGGTGAAAGTCGATATTCAAGATGTCTTCCTGCTCGCGGCACCCAGAGAAGATGCGGACTTTGACCCAGAA
GAGGAAGCAAAGAGAGAGAATGCGCTGAAGATGGAACGGGTCGAGAGCGCCGAGATTCTGCGCGAGCGCAATGCG
GAAGGCATGAGCCAAGAGGAACAGCGCCGGAATCAGAGCTTCACACAGAGCATGATCACGGCCGTGGTGGACAAC
CTGCAGATTTCTATCAAGAATGTGCATTTCCGCTACGAAGACTCTATCGCATCACCTGGGCATCCGTTTGCTGTC
GGCGTGACACTCAAGGAATTGAGTGCCGTCAGCACAGACGGGGAATGGAATCCGACTTTCATCCAATCCGACTCA
AGTGTCACGCATAAATTGGCCGTCCTCGGTGCTCTTTCGGCTTATTGGAATACTGATGCCAAATTGCTGGGAACC
GGGCGAGGCTCGGATATAGGCGCAGAGGCCCAGGGAATCAGCCGCGCTGATCTGATAGAGAAACTGAGAACTGCA
ATTGATGCCGACGAAGGAAACCAATTCATGTTGCGCCCCGTCAGTGGCCGTGCTGGTCTGGAAATGGACAAGTCA
GGCACATATGAACGGCCCGCAATCAAAGCACGGTTGCTCTTCGATGAGCTCGGCTTTGTTCTTGATGAGAAACAA
TATCGCGACGCGTTGATGCTGGTCGATCTATTCCATTATTTCATTCGCCATCAGGAACATAAGAAAATCCAGCCT
AAGGCCTCACCAAAGGAAGACCCTCGGGCATGGATGAGGTTCGCAGGAGAAGCCGTTCTGAGCAAGATCCACGAA
CGAAACAGGCGCTGGACCTGGGACTATATCAAGGAGCGCAGAGATGACCGCATCGCGTACATTGCCTTGTTCAAA
AAAACGAAGAAGGAAGAGGCTTTTACGCCCGAAGAAACCAAGGAACTGCAGAGACTGGAAGCAAAACTGAGCTAC
GAAGATATCCGATTCTGGCGCTCACTTGCACGGAACCAGCTACGAAAAGAAAATGTCGGGGTCAAAAAGCCCGCA
GAACAACAATCATGGTCTGCCTGGCTCTGGGGCGCTAAGAAAGAAGAGTCCGAGGAGACTGCTATGACTGAAGAA
CAGCGACAAGAGTTGTATAATGCCATCGATTGGGATGAAAAGAAGGCTATCACCGAGAGTGTGGATGTGCCCCGG
GAATGGGTCAAACTTCAGGTCAATTGGAGTCTTCGAGCTGGTAGCTTTACGTTAATCCAGGACCCTCACGGGTCA
GCCAATGAGGTCATGAAGCTAGTGTTTGACAATTTCCGAGCCAAGGCACTTCAACGCCATGATTCTTATCTCCTT
GATCTGGACCTTGGAGGGCTGAAGATGTATGATGGCACTACTGCCGGGACTCTTTATCCCCAGATCGTCAAGGTC
AAGGATTCTCCCCCTGAATCTACAAAGGTTGAAGAGCTAAGCGAGGATGATGATGAGCTCGCCTCACAAACTAGC
GCAGACGATCTTCAGGATGAGGACAGTTTGTTCCATCTGCAACTGGAGAAGAACCCGCTCGACAGCGATGCAGAT
ACGGCGGTAAAGGTCAAGCTGAAGAGTATTGAGGTCATTTACAACCCTCGATTCCTCGTAGGAATTGTGAAGTTC
TTTGAGCCGCCCGAGCGACACATGGAGTCGATTGGTGCTCTCTTAGATACCGCGGGTGCCACGGTTGAAGGACTG
CGGCAGCAAACCCGGGCCGGCCTCGAGTTTGCCTTGCAAGAACACAAGAAGGTTGATGCGCAATTCGATATCCAC
GCGCCTTTGATTATTGTACCAGAAAGCATCACACAACCAAGTTCACTTTGTTTGATTATCGACGCCGGTCATGCC
AGTGTCAACAGCGAATTGGTCGACCGCAAAGCGATGCGAGAAATTCAGTCCAAGCAGAAAAAACAATATGCGGAG
GATGATTACAAGCAACTGGAGCATCTGATGTACGATCGCTTCCTCATCAAACTGGACTCCACCCAAGTCCTCATC
GGACCTGGCGTCGATGCAACCAAAGCGCAGCTCAACACGAATGTCGAATCTAGGAATTTCCACATCATCGACCGT
ATCAATGTCGACTTTGCCCTGGAGATGTGTATCGTACCGAGCGTGACACAGCTTACCCGAACGCGCATCTCTGGA
CATCTGCCAGAGCTTCACGCATCAATATCAGACACCAAATACAAGGGCTTGATGAAATTGATTGATATTGCAATC
CCGGAATTCGATACGGAAAAGTCTGCCTCTGATTCAGTTACTGCAGCAGCCAAGGAAGAAGCAGCCCTAGCCACA
CGAGACAGGTCATCATCCTTCCAACCAGCAGTCCAACGTGACCTCCCTGTTGTTGACGACGATGAGGATGAAGTA
GACAGCGAACATGCAAAGAAGCGTGTCGATACACCGGCCAATATCCATCGCCGAGACTTCGAATTCAAATTCACT
GTTGGCCGTCTACGTGGATCACTCTCCCGTTCTGACCCCCATGACCCGCAACGGGATCAGTTGCTGGTTGAACTG
GTTGCCGAAGGATTTGAGCTGGACTTTTATATGCGCCCCTATGACATGGTCGCTGAGGTTATTCTGAAATCTTTA
AGCGTAGATGATCACATCGAGGAGAATCCGGTTCCTGAATTCAAGAGAATCATCTCCTCTAAAGGCTTTGATGCC
GACGAAGACAAGGACCTGTTCCAGCTGAAGATGGTACGGGTTAAACCCGAGTCACCCGAGTTTGACTCAACGTAT
GAAGGGGTTGCCATGAACCTTGACATATCAGTCTCCACTATCAATCTTGTCGTGACAAGAAAAACACTTCTCACG
CTTCTAGACTTCACCCTCCTTACATTCACAAATCCTCAACAACCGACTCAACCCAACCCAGAAACAGACAAGGCT
ATTGAAGGGACCGCCAGTGTGGAAGAGAAGCCCGAGCAAGCTGGGAAAATCCGCATCAAGGCTAACCTCAAGAGT
ATTGCTCTCATCCTCAACAATGATGGAGTCCGCTTGGCAACTTTGAGTTTGAACACTGCCGACGTCGGGGTTTTC
CTCGTGGGCAGCTCGATGCTCATCCAGTCTCGGATAGGAAGTCTGACTTTGGTCGACGATGTCAACCTGGGTGCC
GCGGAGGACTCTGATATCCGACGCCTTCTGACCATAGAAGGAGATGATTTCGCGGACTTCAAGTACGAGACATTC
GATCCCGATAGTGAGACACACCCCGGTTATGATTCCGAGGTCTATCTGCGATCTGGTTCGATCAAGATCAATTTT
CTAGAGGAGCCCTACCGGAAGATCATCCACTTCCTCGTCAAGTTTGGCAAGATGCAAGCCATTTTCAATGCAGCT
CGCCAAGCCGCTGCCAGCCAGGCCAACCAACTCCAGGAGAATGCTTCACGTGTGCGGCTTGACATTATTGTGAAG
ACGCCCATTGTAGTTTTCCCTCGCGTTATGACGGACGGTCGCCCTCGAGACACAATCACCGCTCACCTCGGTGAA
ATTTATGCTAAGAATGAATTTGTCCCTATGGATGATGGAAAGGACAGCCCTGCTGTCAACGTCATCTCGACTGGT
GTCCGCAATATTCGCCTGACATCCAACTTCCATTTCGAAGATGGTACATCCGAGGAGCTGGAGATGATTCAGAAG
GTGAACTTGGAGTTCAGCATCTGCTATTTGGAGCATCAAGCAAACAACCCACGCCCAGATATGGAAATCGAGGGT
TCTCTATCTCCAATTAACCTCCGTATCTCCCAGAGCCAGCTCAAGTTCTTGCTGGAACTGTCAAAGTCGATACCG
AACGCGTTTGCCACAGATACCGAACAGCAAGAGCTCGAGGCTATGGAGTCGTTGCCCTCGTCGGTGACTGAACCT
ACTAGGGAGGCTAGTTCAAAGGCCGTCCAAGCACAAAATGGCTCGGGAGGAGCATTCCCTGATGACGAAAACAGA
GAGACTTGGGTACGACTTGATATGATCTTTAAGGTCGACAGTGTCGGCCTGGAGCTTATCCTGGCAAACGACGAC
CAGCCCGTCGGCCGCCTAGAGGACTCCAGTCTGTCCAAGTTCTCTCTCAATGATACTCGAGTCAAGCTGCGTATG
TTGACAGATGGCTCATTGGAGTCGGAGCTCCTCATTCATTCATTCTCCATCCGCGATAGTCGCAAGCAGGACTCG
AACAAGTTTAGAAACATCATGTCTTTGATCAACAACGATGTCCAACAGCAGTTCATGGCTAGCGTGTCCATGTCT
GGAGGACCAGAGAAGCACCTCATTGCGATGCTGACTATTGATAGCCCTCGCATTATGTTTGCTTTAGATTATCTG
TCTGCTTTACAGTCATTCAGCCAGTCTGCATTTGCCTCTGAAGGACCAATAGAGGTGCAGGATGAGAGCGAATCA
CCCGAGGAGTCTGAGTCAGGGTCCGATACTATTGTAAGTTCCAACAAGGCTATAACCGAGGCTTCTTCGGGCGAT
GCCACAGCAGCGGCTATGACCGTTTCATTCCGGGTCAATCTTGTCGACGCTCAGGTGATTATGGTGGCCAACCCT
GCCATTCCTCACTCTGAAGCTATCGTCCTTGGTACCAAGGAAGTTCTCATCTCCCACCAAAATGTGTCGACTCTG
CAGATTCAAAAAGTGGGCATGTTCCTGTGCCGCATGGATAAGTTTGAGACGTCTCGACTCCGCATTCTGGATGAT
TTCACTCTTGAAATGTCCATTGATAGCCGATCGCAAGATAAGGGATCTGCTTTGACCTCCATTGAGGTGCACCTT
GAGCCTTTGGTTCTTCGCTTGTCTCTGCGTGATATTCTGATGGCAATCCAGATTGTCAACAAGGCCTCTGAAATG
ACCCAGAATGCCCAGCAGACTGAGAGCGGAGAGGCGAAGAAAATTACGGACACGAAGACAACCAGAGGGCGTTCT
TCTAGCAAGACATCCTCTGCCGTTGTTAAGAGATCCAACCGCCCGAGTCAAGGAGCTGGAAACCTGGATCGGACA
ACTGCGCCACAAAGTTCAGTTGTCCTCAAGCGCGAAGAGATGTCTGCCAAGATCGACGGAGTTAGAGTCATTCTT
ATTGGTGATCTACACGATCTACCTTTGGTCGATTGGAGCGTCAAGAAATTCAACATCGATGTACGCGACTGGTCA
TCGACACTGAATGCCGATACCAACTTCGAAACGTTCATGAATGTGTATAACTTCTCGAAGTCGGCCTGGGAGCCG
TTGATTGAGCCCTGGCAGCTAGGATTCCACATGGCCAAGGAGACCAACCCGGATGTTTTCTCTTTCGATGTGTAT
TCGCACAAGACAATGGAGCTTACTATAACATCCGCCACGATTGCACTCGCATCCAAATCCTTCCAGTTCCTTTCT
ACTGATCAGGATGTCCTCGCCAAGCCAAGAGGCGCTGATGCCCCATACAGAATCCGCAACTACACTGGGTTTGAC
CTCAGTGTTTGGGCCGATGTCAGCGAAGGAGTGGAAGGCCCGGCGGCGAAACTTACCGACGGCGAAGAAGCCCCA
TGGCGATTTGAAGATTCCACCGCTATCCGTGAATCGCTGACCCCAGAAGGCCACGGCGGAGTGGTTGGTGTCAAA
CTGGAAGGCAGTGGCTTCGATAGTATCAGCCGCATTCCTGTCGTGCGTGAGGGCGAGGTTATCTACGCTCTGAAG
CCGAAGCAACAAAGTGTTCTTCACCGGCTACTCGTGGAAGTCAAACTGGGACCCGATAATGTCAAGTACATCACA
TTCCGTTCGCCACTTCTTATCGAGAACAATACCCAAATTCCCGTGGAAATGGGCATTTTCAGCCCCGGAGAAGGC
CACTTGCTGAAGATTGAGAAGATTTTGCCTGGGGACGCACGACCGGCACCCGTTGGATCAGCATATCTCCATTCT
ATCGTTGTTCGTCCCGATCAGGGCTTCGGATATGACTGGTCAGATGAGCGATTGTTCTGGAAGGACCTCATCAAG
CGACCTACACGCACGGTTAAGTGCATTAGCGAAAATGGACAGCAGGCTCCTCCTTTCTATTTCCAAGTCAACGCA
ACGTTTGATAGCAAGGATTCGCTTACGAGCGTGTATCCCTACATGAGGATCCGAATCTTCGCTCCCGTGGAGATT
CAGAACCTGTTGCCCTACGATTTCAAGTACCGCATCTACGACAAGAACACCAAGAAGGATTGGACGAACTTCTTG
AGGAAGGGTGGCGTCAGCCCGGTTCACGTCGTGGAGCTTTCCCACTTGCTGTTGCTCAGCATTGATCTGCAAGAT
TCGGTCTTCCGCCAGAGCGAATTTGCTATTGTCAACGGCAATGCCCAAGACTACCGCAGAGAGCATACCTTGACT
CTTAAGGATGAGCGAGGTCTTCAACTGAGGTTACAGCTTCATTACTTCAACATTCCTAACAGTGGTGGTGCTTTC
AAGGTTTCTGTGTACAGCCCATACCTTGTCTTGAACAAGACTGGCCTTCCTATGGACATTCAAAGCAAAGCATTC
CTCCAATCTGCGAGAAATGCCGCTGGTCAAGGACTCAGAGCCGATCCAAGAGACGAGGGCCGCGCACTTCCATAC
ATGTACTCTTATGCCAACGAGGACCAAAGCAACCGATCTATCTTGAAGGTCAGCGATTCTGCATGGAGTAAGCCG
CAGAGTTTCGAGGCTATTGGTAGTACCTTTGAGGTCATCTTCCCAGATCGCCAAGGCCGATCTGAGTTCCACTCC
GGAGTGTCTGTTGCTGAAGGCGAGGGCAAGTACAAGATGACCAAGGTGGTCACTCTTGCTCCACGGTTCATCCTA
AAGAGCAAGCTCAACGAAGATCTTCTGGCTCGCGAGCCAGGCTCCTCCAACGTACTCCAGGTCAAAAACGGGCAG
TTGGTACCGCTTCATTTCCTTCGTCAAGTTCAAGAGAAACAGCTGTGCCTCTGCTTCCCGGGCGTCAACAACCAA
TGGTCTTCCCCGTTCAACATCGCCGATGTGGGAACCGTGCACGTGAAATTGGCCAAGGCGAACCAGCGGCAGAAG
TTGATCAAGATTGATATCATCATGGAAGGAGCAACTCTTTTCTTGCACTTCAGCCTTGAGCAACGCAATTGGCCG
TTCTCCATGCGTAACGAAAGCGATATGGAGTTCATTTTCTACCAAGCCAATCCAAATGTGGAAGATGATGATGAA
GAAGACCAGACTAGCGGCTGGAGGCCGATCCGGTATCGGATTCCCGCGCGGAGCATCATGCCGTATGCATGGGAC
TACCCGGCGACGAAGAACAAGTCGCTCGTGTTGACCTGCCAGGGCAAAGAGCGCCATATCAAACTTGCCGAGATA
GGAAACCTGATCCCAATGCGGATTCCAGCTTCGCAGCCTGGCGAACACCAGAAGATCATTGACATCAACATTGCT
GCTGATGGCCCCACCCAGACTCTTGTGCTATCCAACTTCAAACCGTCGAAGAGTATGTACAAGCAACAAAGTAGA
CAATCCTCCCAGGTCGGCTCCACGGCTGGGTTCGAGATCAAGGAAATGAATTCGGACGTCAACTTCAAGGCCCAA
CTTCGCCTAGGTGGCATTGGAATTTCATTGATCAACCAGAACCTGAAAGAGCTGCTGTATCTCACATTCCGCGAG
ATTGAGTTCAAGTTCAGGGAATCGAGGTTGTACCAGACTCTGAACGCAACTATCAAATGGATCCAGATCGACAAC
CAGCTCTACGGTGGTATTTTCCCCATCTTGCTTTACCCCAGTGTCGTTCCGAAGACTGGCAAGGAGATGGAAGCA
CACCCGATCTTCCATGCAATGGTTACACGGGTTAAGGACGACTCGTATGGTGTTCTGTATATCAAGTACGCGACC
TTGCTATTGCAGCAAATGACACTTGAACTGGATGAGGACTTCGTCCTTGCCATGCTTGACTTTGTCAAGATTCCG
GGTGCTTCGTGGGCCGAGGAGCAAGAGGGCAAACTGTGCGATGAAGACCTCAACATTCCAGAGCCGCGACAAGAA
GACAATGGTCAGGATGTGTACTTCGAGCTCTTGCATCTCCAGCCAATGCAGATGGATATTTCATTCATGCGCACC
GAGCGCGTCAATGTGGAAGATACTATGCAGCCCTCCAACCCGTTGATGTTCTTTGTCAACGTCATGACAATGTCG
ATGGGTAATGTCAATGATGCACCAGTCCGACTCAATGCTCTGATGCTCGAGAATGCCCGTGTCTCTTTCCCCAGC
CTGGTCGCCAATATCCGTGCACACTATACCCAAGAATTCCTGGGCCAGATCCATATCATTCTCGGTTCGGCCGAC
TTCCTAGGCAACCCTGTCGGTTTGTTCAACAATGTCAGCTCTGGTGTCGCCGCTATCTTCTATGAGCCATATCAG
GGTTTGGTCATGACCGACCGTCCCCAAGAGCTGGGTCTTGGTATCGCAAAGGGTGCTACCAGCTTCATGAAGAAG
TCCATCTTCGGATTCTCGGACAGTATGGCCAAGCTTACGGGAAGTATGTCCAAGGGTCTCGCCGCCGCTACACTT
GATAAGGAGTTCCAAAACCAGCGCCGAATGTCCAAGGTGCGCAACCGCCCCAAGCACGCGCTGTATGGAATCACG
GCTGGTGGCAGTGCCTTTGCAACTAGTCTTGCAAGCGGTATCGGTGGCTTGGCACGTCATCCACTGCAAGGTGCG
GAGAAAGAAGGTATCCAAGGATTCTTCAAAGGTGTTGGAAAGGGTGTCCTTGGATTGGCTACCAAGCCAGCGATC
GGTGCATTCGATCTTGCCTCTAATTTGGCAGAAGGTGTTCGCAACACCACTACTGTTTTCGATGCTGAAGGTCTC
GACCGTGTTCGACTCACCCGCTTTATTGGCACCGATGGCATTGTGCGCCCGTACTCGCAGCGCGAAGCTCTCGGA
CAGTTCTGGCTGAAGACCACGGACGACGGCAAATACTTCGACGAAGACTACATTGCCCACCTAGAGCTGCCTGGC
CGAGACATGCTGGTCTTGTTGACGTACGCACGTATCATGCTGGTGCGCACGAAGAAGCTGTATACTGAGTGGGAT
ATCCGCCTCACGGATATCCAGACCATTTCCAAGGAGCGCACGGGAATGAGTATCACGCTCAAGGGTGGTGCCAAC
GGACCTTTCATTCCTGTCCAAGATGAAAGCTCGCGGAACTGGCTCTATAGACAGATTGCTGTCGCGGTCAATGCT
TTCAACGAGAAGTATAATTCCAGGGGATAG
Transcript >Pro_DTO377G3_2|g3697.t1
ATGTTGGAGGGAGTAGTAGCGAACCTACTGAATCGGTTCCTGGGAATTTACGTCAAGAACTTCGATGCGACCCAG
CTCAACATCGGAATCTGGTCAGGCGACGTCAAGCTACGGAACCTTGAACTACGCCGCGAAGCGCTCGATCAGCTA
CGCCTCCCTCTAAACGTCGTCGAAGGCCATCTCGGAGAGCTTACACTATCAATCCCATGGTCAAACCTACGAGGC
AAACCGGTGAAAGTCGATATTCAAGATGTCTTCCTGCTCGCGGCACCCAGAGAAGATGCGGACTTTGACCCAGAA
GAGGAAGCAAAGAGAGAGAATGCGCTGAAGATGGAACGGGTCGAGAGCGCCGAGATTCTGCGCGAGCGCAATGCG
GAAGGCATGAGCCAAGAGGAACAGCGCCGGAATCAGAGCTTCACACAGAGCATGATCACGGCCGTGGTGGACAAC
CTGCAGATTTCTATCAAGAATGTGCATTTCCGCTACGAAGACTCTATCGCATCACCTGGGCATCCGTTTGCTGTC
GGCGTGACACTCAAGGAATTGAGTGCCGTCAGCACAGACGGGGAATGGAATCCGACTTTCATCCAATCCGACTCA
AGTGTCACGCATAAATTGGCCGTCCTCGGTGCTCTTTCGGCTTATTGGAATACTGATGCCAAATTGCTGGGAACC
GGGCGAGGCTCGGATATAGGCGCAGAGGCCCAGGGAATCAGCCGCGCTGATCTGATAGAGAAACTGAGAACTGCA
ATTGATGCCGACGAAGGAAACCAATTCATGTTGCGCCCCGTCAGTGGCCGTGCTGGTCTGGAAATGGACAAGTCA
GGCACATATGAACGGCCCGCAATCAAAGCACGGTTGCTCTTCGATGAGCTCGGCTTTGTTCTTGATGAGAAACAA
TATCGCGACGCGTTGATGCTGGTCGATCTATTCCATTATTTCATTCGCCATCAGGAACATAAGAAAATCCAGCCT
AAGGCCTCACCAAAGGAAGACCCTCGGGCATGGATGAGGTTCGCAGGAGAAGCCGTTCTGAGCAAGATCCACGAA
CGAAACAGGCGCTGGACCTGGGACTATATCAAGGAGCGCAGAGATGACCGCATCGCGTACATTGCCTTGTTCAAA
AAAACGAAGAAGGAAGAGGCTTTTACGCCCGAAGAAACCAAGGAACTGCAGAGACTGGAAGCAAAACTGAGCTAC
GAAGATATCCGATTCTGGCGCTCACTTGCACGGAACCAGCTACGAAAAGAAAATGTCGGGGTCAAAAAGCCCGCA
GAACAACAATCATGGTCTGCCTGGCTCTGGGGCGCTAAGAAAGAAGAGTCCGAGGAGACTGCTATGACTGAAGAA
CAGCGACAAGAGTTGTATAATGCCATCGATTGGGATGAAAAGAAGGCTATCACCGAGAGTGTGGATGTGCCCCGG
GAATGGGTCAAACTTCAGGTCAATTGGAGTCTTCGAGCTGGTAGCTTTACGTTAATCCAGGACCCTCACGGGTCA
GCCAATGAGGTCATGAAGCTAGTGTTTGACAATTTCCGAGCCAAGGCACTTCAACGCCATGATTCTTATCTCCTT
GATCTGGACCTTGGAGGGCTGAAGATGTATGATGGCACTACTGCCGGGACTCTTTATCCCCAGATCGTCAAGGTC
AAGGATTCTCCCCCTGAATCTACAAAGGTTGAAGAGCTAAGCGAGGATGATGATGAGCTCGCCTCACAAACTAGC
GCAGACGATCTTCAGGATGAGGACAGTTTGTTCCATCTGCAACTGGAGAAGAACCCGCTCGACAGCGATGCAGAT
ACGGCGGTAAAGGTCAAGCTGAAGAGTATTGAGGTCATTTACAACCCTCGATTCCTCGTAGGAATTGTGAAGTTC
TTTGAGCCGCCCGAGCGACACATGGAGTCGATTGGTGCTCTCTTAGATACCGCGGGTGCCACGGTTGAAGGACTG
CGGCAGCAAACCCGGGCCGGCCTCGAGTTTGCCTTGCAAGAACACAAGAAGGTTGATGCGCAATTCGATATCCAC
GCGCCTTTGATTATTGTACCAGAAAGCATCACACAACCAAGTTCACTTTGTTTGATTATCGACGCCGGTCATGCC
AGTGTCAACAGCGAATTGGTCGACCGCAAAGCGATGCGAGAAATTCAGTCCAAGCAGAAAAAACAATATGCGGAG
GATGATTACAAGCAACTGGAGCATCTGATGTACGATCGCTTCCTCATCAAACTGGACTCCACCCAAGTCCTCATC
GGACCTGGCGTCGATGCAACCAAAGCGCAGCTCAACACGAATGTCGAATCTAGGAATTTCCACATCATCGACCGT
ATCAATGTCGACTTTGCCCTGGAGATGTGTATCGTACCGAGCGTGACACAGCTTACCCGAACGCGCATCTCTGGA
CATCTGCCAGAGCTTCACGCATCAATATCAGACACCAAATACAAGGGCTTGATGAAATTGATTGATATTGCAATC
CCGGAATTCGATACGGAAAAGTCTGCCTCTGATTCAGTTACTGCAGCAGCCAAGGAAGAAGCAGCCCTAGCCACA
CGAGACAGGTCATCATCCTTCCAACCAGCAGTCCAACGTGACCTCCCTGTTGTTGACGACGATGAGGATGAAGTA
GACAGCGAACATGCAAAGAAGCGTGTCGATACACCGGCCAATATCCATCGCCGAGACTTCGAATTCAAATTCACT
GTTGGCCGTCTACGTGGATCACTCTCCCGTTCTGACCCCCATGACCCGCAACGGGATCAGTTGCTGGTTGAACTG
GTTGCCGAAGGATTTGAGCTGGACTTTTATATGCGCCCCTATGACATGGTCGCTGAGGTTATTCTGAAATCTTTA
AGCGTAGATGATCACATCGAGGAGAATCCGGTTCCTGAATTCAAGAGAATCATCTCCTCTAAAGGCTTTGATGCC
GACGAAGACAAGGACCTGTTCCAGCTGAAGATGGTACGGGTTAAACCCGAGTCACCCGAGTTTGACTCAACGTAT
GAAGGGGTTGCCATGAACCTTGACATATCAGTCTCCACTATCAATCTTGTCGTGACAAGAAAAACACTTCTCACG
CTTCTAGACTTCACCCTCCTTACATTCACAAATCCTCAACAACCGACTCAACCCAACCCAGAAACAGACAAGGCT
ATTGAAGGGACCGCCAGTGTGGAAGAGAAGCCCGAGCAAGCTGGGAAAATCCGCATCAAGGCTAACCTCAAGAGT
ATTGCTCTCATCCTCAACAATGATGGAGTCCGCTTGGCAACTTTGAGTTTGAACACTGCCGACGTCGGGGTTTTC
CTCGTGGGCAGCTCGATGCTCATCCAGTCTCGGATAGGAAGTCTGACTTTGGTCGACGATGTCAACCTGGGTGCC
GCGGAGGACTCTGATATCCGACGCCTTCTGACCATAGAAGGAGATGATTTCGCGGACTTCAAGTACGAGACATTC
GATCCCGATAGTGAGACACACCCCGGTTATGATTCCGAGGTCTATCTGCGATCTGGTTCGATCAAGATCAATTTT
CTAGAGGAGCCCTACCGGAAGATCATCCACTTCCTCGTCAAGTTTGGCAAGATGCAAGCCATTTTCAATGCAGCT
CGCCAAGCCGCTGCCAGCCAGGCCAACCAACTCCAGGAGAATGCTTCACGTGTGCGGCTTGACATTATTGTGAAG
ACGCCCATTGTAGTTTTCCCTCGCGTTATGACGGACGGTCGCCCTCGAGACACAATCACCGCTCACCTCGGTGAA
ATTTATGCTAAGAATGAATTTGTCCCTATGGATGATGGAAAGGACAGCCCTGCTGTCAACGTCATCTCGACTGGT
GTCCGCAATATTCGCCTGACATCCAACTTCCATTTCGAAGATGGTACATCCGAGGAGCTGGAGATGATTCAGAAG
GTGAACTTGGAGTTCAGCATCTGCTATTTGGAGCATCAAGCAAACAACCCACGCCCAGATATGGAAATCGAGGGT
TCTCTATCTCCAATTAACCTCCGTATCTCCCAGAGCCAGCTCAAGTTCTTGCTGGAACTGTCAAAGTCGATACCG
AACGCGTTTGCCACAGATACCGAACAGCAAGAGCTCGAGGCTATGGAGTCGTTGCCCTCGTCGGTGACTGAACCT
ACTAGGGAGGCTAGTTCAAAGGCCGTCCAAGCACAAAATGGCTCGGGAGGAGCATTCCCTGATGACGAAAACAGA
GAGACTTGGGTACGACTTGATATGATCTTTAAGGTCGACAGTGTCGGCCTGGAGCTTATCCTGGCAAACGACGAC
CAGCCCGTCGGCCGCCTAGAGGACTCCAGTCTGTCCAAGTTCTCTCTCAATGATACTCGAGTCAAGCTGCGTATG
TTGACAGATGGCTCATTGGAGTCGGAGCTCCTCATTCATTCATTCTCCATCCGCGATAGTCGCAAGCAGGACTCG
AACAAGTTTAGAAACATCATGTCTTTGATCAACAACGATGTCCAACAGCAGTTCATGGCTAGCGTGTCCATGTCT
GGAGGACCAGAGAAGCACCTCATTGCGATGCTGACTATTGATAGCCCTCGCATTATGTTTGCTTTAGATTATCTG
TCTGCTTTACAGTCATTCAGCCAGTCTGCATTTGCCTCTGAAGGACCAATAGAGGTGCAGGATGAGAGCGAATCA
CCCGAGGAGTCTGAGTCAGGGTCCGATACTATTGTAAGTTCCAACAAGGCTATAACCGAGGCTTCTTCGGGCGAT
GCCACAGCAGCGGCTATGACCGTTTCATTCCGGGTCAATCTTGTCGACGCTCAGGTGATTATGGTGGCCAACCCT
GCCATTCCTCACTCTGAAGCTATCGTCCTTGGTACCAAGGAAGTTCTCATCTCCCACCAAAATGTGTCGACTCTG
CAGATTCAAAAAGTGGGCATGTTCCTGTGCCGCATGGATAAGTTTGAGACGTCTCGACTCCGCATTCTGGATGAT
TTCACTCTTGAAATGTCCATTGATAGCCGATCGCAAGATAAGGGATCTGCTTTGACCTCCATTGAGGTGCACCTT
GAGCCTTTGGTTCTTCGCTTGTCTCTGCGTGATATTCTGATGGCAATCCAGATTGTCAACAAGGCCTCTGAAATG
ACCCAGAATGCCCAGCAGACTGAGAGCGGAGAGGCGAAGAAAATTACGGACACGAAGACAACCAGAGGGCGTTCT
TCTAGCAAGACATCCTCTGCCGTTGTTAAGAGATCCAACCGCCCGAGTCAAGGAGCTGGAAACCTGGATCGGACA
ACTGCGCCACAAAGTTCAGTTGTCCTCAAGCGCGAAGAGATGTCTGCCAAGATCGACGGAGTTAGAGTCATTCTT
ATTGGTGATCTACACGATCTACCTTTGGTCGATTGGAGCGTCAAGAAATTCAACATCGATGTACGCGACTGGTCA
TCGACACTGAATGCCGATACCAACTTCGAAACGTTCATGAATGTGTATAACTTCTCGAAGTCGGCCTGGGAGCCG
TTGATTGAGCCCTGGCAGCTAGGATTCCACATGGCCAAGGAGACCAACCCGGATGTTTTCTCTTTCGATGTGTAT
TCGCACAAGACAATGGAGCTTACTATAACATCCGCCACGATTGCACTCGCATCCAAATCCTTCCAGTTCCTTTCT
ACTGATCAGGATGTCCTCGCCAAGCCAAGAGGCGCTGATGCCCCATACAGAATCCGCAACTACACTGGGTTTGAC
CTCAGTGTTTGGGCCGATGTCAGCGAAGGAGTGGAAGGCCCGGCGGCGAAACTTACCGACGGCGAAGAAGCCCCA
TGGCGATTTGAAGATTCCACCGCTATCCGTGAATCGCTGACCCCAGAAGGCCACGGCGGAGTGGTTGGTGTCAAA
CTGGAAGGCAGTGGCTTCGATAGTATCAGCCGCATTCCTGTCGTGCGTGAGGGCGAGGTTATCTACGCTCTGAAG
CCGAAGCAACAAAGTGTTCTTCACCGGCTACTCGTGGAAGTCAAACTGGGACCCGATAATGTCAAGTACATCACA
TTCCGTTCGCCACTTCTTATCGAGAACAATACCCAAATTCCCGTGGAAATGGGCATTTTCAGCCCCGGAGAAGGC
CACTTGCTGAAGATTGAGAAGATTTTGCCTGGGGACGCACGACCGGCACCCGTTGGATCAGCATATCTCCATTCT
ATCGTTGTTCGTCCCGATCAGGGCTTCGGATATGACTGGTCAGATGAGCGATTGTTCTGGAAGGACCTCATCAAG
CGACCTACACGCACGGTTAAGTGCATTAGCGAAAATGGACAGCAGGCTCCTCCTTTCTATTTCCAAGTCAACGCA
ACGTTTGATAGCAAGGATTCGCTTACGAGCGTGTATCCCTACATGAGGATCCGAATCTTCGCTCCCGTGGAGATT
CAGAACCTGTTGCCCTACGATTTCAAGTACCGCATCTACGACAAGAACACCAAGAAGGATTGGACGAACTTCTTG
AGGAAGGGTGGCGTCAGCCCGGTTCACGTCGTGGAGCTTTCCCACTTGCTGTTGCTCAGCATTGATCTGCAAGAT
TCGGTCTTCCGCCAGAGCGAATTTGCTATTGTCAACGGCAATGCCCAAGACTACCGCAGAGAGCATACCTTGACT
CTTAAGGATGAGCGAGGTCTTCAACTGAGGTTACAGCTTCATTACTTCAACATTCCTAACAGTGGTGGTGCTTTC
AAGGTTTCTGTGTACAGCCCATACCTTGTCTTGAACAAGACTGGCCTTCCTATGGACATTCAAAGCAAAGCATTC
CTCCAATCTGCGAGAAATGCCGCTGGTCAAGGACTCAGAGCCGATCCAAGAGACGAGGGCCGCGCACTTCCATAC
ATGTACTCTTATGCCAACGAGGACCAAAGCAACCGATCTATCTTGAAGGTCAGCGATTCTGCATGGAGTAAGCCG
CAGAGTTTCGAGGCTATTGGTAGTACCTTTGAGGTCATCTTCCCAGATCGCCAAGGCCGATCTGAGTTCCACTCC
GGAGTGTCTGTTGCTGAAGGCGAGGGCAAGTACAAGATGACCAAGGTGGTCACTCTTGCTCCACGGTTCATCCTA
AAGAGCAAGCTCAACGAAGATCTTCTGGCTCGCGAGCCAGGCTCCTCCAACGTACTCCAGGTCAAAAACGGGCAG
TTGGTACCGCTTCATTTCCTTCGTCAAGTTCAAGAGAAACAGCTGTGCCTCTGCTTCCCGGGCGTCAACAACCAA
TGGTCTTCCCCGTTCAACATCGCCGATGTGGGAACCGTGCACGTGAAATTGGCCAAGGCGAACCAGCGGCAGAAG
TTGATCAAGATTGATATCATCATGGAAGGAGCAACTCTTTTCTTGCACTTCAGCCTTGAGCAACGCAATTGGCCG
TTCTCCATGCGTAACGAAAGCGATATGGAGTTCATTTTCTACCAAGCCAATCCAAATGTGGAAGATGATGATGAA
GAAGACCAGACTAGCGGCTGGAGGCCGATCCGGTATCGGATTCCCGCGCGGAGCATCATGCCGTATGCATGGGAC
TACCCGGCGACGAAGAACAAGTCGCTCGTGTTGACCTGCCAGGGCAAAGAGCGCCATATCAAACTTGCCGAGATA
GGAAACCTGATCCCAATGCGGATTCCAGCTTCGCAGCCTGGCGAACACCAGAAGATCATTGACATCAACATTGCT
GCTGATGGCCCCACCCAGACTCTTGTGCTATCCAACTTCAAACCGTCGAAGAGTATGTACAAGCAACAAAGTAGA
CAATCCTCCCAGGTCGGCTCCACGGCTGGGTTCGAGATCAAGGAAATGAATTCGGACGTCAACTTCAAGGCCCAA
CTTCGCCTAGGTGGCATTGGAATTTCATTGATCAACCAGAACCTGAAAGAGCTGCTGTATCTCACATTCCGCGAG
ATTGAGTTCAAGTTCAGGGAATCGAGGTTGTACCAGACTCTGAACGCAACTATCAAATGGATCCAGATCGACAAC
CAGCTCTACGGTGGTATTTTCCCCATCTTGCTTTACCCCAGTGTCGTTCCGAAGACTGGCAAGGAGATGGAAGCA
CACCCGATCTTCCATGCAATGGTTACACGGGTTAAGGACGACTCGTATGGTGTTCTGTATATCAAGTACGCGACC
TTGCTATTGCAGCAAATGACACTTGAACTGGATGAGGACTTCGTCCTTGCCATGCTTGACTTTGTCAAGATTCCG
GGTGCTTCGTGGGCCGAGGAGCAAGAGGGCAAACTGTGCGATGAAGACCTCAACATTCCAGAGCCGCGACAAGAA
GACAATGGTCAGGATGTGTACTTCGAGCTCTTGCATCTCCAGCCAATGCAGATGGATATTTCATTCATGCGCACC
GAGCGCGTCAATGTGGAAGATACTATGCAGCCCTCCAACCCGTTGATGTTCTTTGTCAACGTCATGACAATGTCG
ATGGGTAATGTCAATGATGCACCAGTCCGACTCAATGCTCTGATGCTCGAGAATGCCCGTGTCTCTTTCCCCAGC
CTGGTCGCCAATATCCGTGCACACTATACCCAAGAATTCCTGGGCCAGATCCATATCATTCTCGGTTCGGCCGAC
TTCCTAGGCAACCCTGTCGGTTTGTTCAACAATGTCAGCTCTGGTGTCGCCGCTATCTTCTATGAGCCATATCAG
GGTTTGGTCATGACCGACCGTCCCCAAGAGCTGGGTCTTGGTATCGCAAAGGGTGCTACCAGCTTCATGAAGAAG
TCCATCTTCGGATTCTCGGACAGTATGGCCAAGCTTACGGGAAGTATGTCCAAGGGTCTCGCCGCCGCTACACTT
GATAAGGAGTTCCAAAACCAGCGCCGAATGTCCAAGGTGCGCAACCGCCCCAAGCACGCGCTGTATGGAATCACG
GCTGGTGGCAGTGCCTTTGCAACTAGTCTTGCAAGCGGTATCGGTGGCTTGGCACGTCATCCACTGCAAGGTGCG
GAGAAAGAAGGTATCCAAGGATTCTTCAAAGGTGTTGGAAAGGGTGTCCTTGGATTGGCTACCAAGCCAGCGATC
GGTGCATTCGATCTTGCCTCTAATTTGGCAGAAGGTGTTCGCAACACCACTACTGTTTTCGATGCTGAAGGTCTC
GACCGTGTTCGACTCACCCGCTTTATTGGCACCGATGGCATTGTGCGCCCGTACTCGCAGCGCGAAGCTCTCGGA
CAGTTCTGGCTGAAGACCACGGACGACGGCAAATACTTCGACGAAGACTACATTGCCCACCTAGAGCTGCCTGGC
CGAGACATGCTGGTCTTGTTGACGTACGCACGTATCATGCTGGTGCGCACGAAGAAGCTGTATACTGAGTGGGAT
ATCCGCCTCACGGATATCCAGACCATTTCCAAGGAGCGCACGGGAATGAGTATCACGCTCAAGGGTGGTGCCAAC
GGACCTTTCATTCCTGTCCAAGATGAAAGCTCGCGGAACTGGCTCTATAGACAGATTGCTGTCGCGGTCAATGCT
TTCAACGAGAAGTATAATTCCAGGGGATAG
Gene >Pro_DTO377G3_2|g3697.t1
ATGTTGGAGGGAGTAGTAGCGAACCTACTGAATCGGTTCCTGGGAATTTACGTCAAGAACTTCGATGCGACCCAG
CTCAACATCGGAATCTGGTCAGGCGACGTCAAGCTACGGAACCTTGAACTACGCCGCGAAGCGCTCGATCAGCTA
CGCCTCCCTCTAAACGTCGTCGAAGGCCATCTCGGAGAGCTTACACTATCAATCCCATGGTCAAACCTACGAGGC
AAACCGGTGAAAGTCGATATTCAAGATGTCTTCCTGCTCGCGGCACCCAGAGAAGATGCGGACTTTGACCCAGAA
GAGGAAGCAAAGAGAGAGAATGCGCTGAAGATGGAACGGGTCGAGAGCGCCGAGATTCTGCGCGAGCGCAATGCG
GAAGGCATGAGCCAAGAGGAACAGCGCCGGAATCAGAGCTTCACACAGAGCATGATCACGGCCGTGGTGGACAAC
CTGCAGATTTCTATCAAGAATGTGCATTTCCGCTACGAAGACTCTATCGCATCACCTGGGCATCCGTTTGCTGTC
GGCGTGACACTCAAGGAATTGAGTGCCGTCAGCACAGACGGGGAATGGAATCCGACTTTCATCCAATCCGACTCA
AGTGTCACGCATAAATTGGCCGTCCTCGGTGCTCTTTCGGCTTATTGGAATACTGATGCCAAATTGCTGGGAACC
GGGCGAGGCTCGGATATAGGCGCAGAGGCCCAGGGAATCAGCCGCGCTGATCTGATAGAGAAACTGAGAACTGCA
ATTGATGCCGACGAAGGAAACCAATTCATGTTGCGCCCCGTCAGTGGCCGTGCTGGTCTGGAAATGGACAAGTCA
GGCACATATGAACGGCCCGCAATCAAAGCACGGTTGCTCTTCGATGAGCTCGGCTTTGTTCTTGATGAGAAACAA
TATCGCGACGCGTTGATGCTGGTCGATCTATTCCATTATTTCATTCGCCATCAGGAACATAAGAAAATCCAGCCT
AAGGCCTCACCAAAGGAAGACCCTCGGGCATGGATGAGGTTCGCAGGAGAAGCCGTTCTGAGCAAGATCCACGAA
CGAAACAGGCGCTGGACCTGGGACTATATCAAGGAGCGCAGAGATGACCGCATCGCGTACATTGCCTTGTTCAAA
AAAACGAAGAAGGAAGAGGCTTTTACGCCCGAAGAAACCAAGGAACTGCAGAGACTGGAAGCAAAACTGAGCTAC
GAAGATATCCGATTCTGGCGCTCACTTGCACGGAACCAGCTACGAAAAGAAAATGTCGGGGTCAAAAAGCCCGCA
GAACAACAATCATGGTCTGCCTGGCTCTGGGGCGCTAAGAAAGAAGAGTCCGAGGAGACTGCTATGACTGAAGAA
CAGCGACAAGAGTTGTATAATGCCATCGATTGGGATGAAAAGAAGGCTATCACCGAGAGTGTGGATGTGCCCCGG
GAATGGGTCAAACTTCAGGTCAATTGGAGTCTTCGAGCTGGTAGCTTTACGTTAATCCAGGACCCTCACGGGTCA
GCCAATGAGGTCATGAAGCTAGTGTTTGACAATTTCCGAGCCAAGGCACTTCAACGCCATGATTCTTATCTCCTT
GATCTGGACCTTGGAGGGCTGAAGATGTATGATGGCACTACTGCCGGGACTCTTTATCCCCAGATCGTCAAGGTC
AAGGATTCTCCCCCTGAATCTACAAAGGTTGAAGAGCTAAGCGAGGATGATGATGAGCTCGCCTCACAAACTAGC
GCAGACGATCTTCAGGATGAGGACAGTTTGTTCCATCTGCAACTGGAGAAGAACCCGCTCGACAGCGATGCAGAT
ACGGCGGTAAAGGTCAAGCTGAAGAGTATTGAGGTCATTTACAACCCTCGATTCCTCGTAGGAATTGTGAAGTTC
TTTGAGCCGCCCGAGCGACACATGGAGTCGATTGGTGCTCTCTTAGATACCGCGGGTGCCACGGTTGAAGGACTG
CGGCAGCAAACCCGGGCCGGCCTCGAGTTTGCCTTGCAAGAACACAAGAAGGTTGATGCGCAATTCGATATCCAC
GCGCCTTTGATTATTGTACCAGAAAGCATCACACAACCAAGTTCACTTTGTTTGATTATCGACGCCGGTCATGCC
AGTGTCAACAGCGAATTGGTCGACCGCAAAGCGATGCGAGAAATTCAGTCCAAGCAGAAAAAACAATATGCGGAG
GATGATTACAAGCAACTGGAGCATCTGATGTACGATCGCTTCCTCATCAAACTGGACTCCACCCAAGTCCTCATC
GGACCTGGCGTCGATGCAACCAAAGCGCAGCTCAACACGAATGTCGAATCTAGGAATTTCCACATCATCGACCGT
ATCAATGTCGACTTTGCCCTGGAGATGTGTATCGTACCGAGCGTGACACAGCTTACCCGAACGCGCATCTCTGGA
CATCTGCCAGAGCTTCACGCATCAATATCAGACACCAAATACAAGGGCTTGATGAAATTGATTGATATTGCAATC
CCGGAATTCGATACGGAAAAGTCTGCCTCTGATTCAGTTACTGCAGCAGCCAAGGAAGAAGCAGCCCTAGCCACA
CGAGACAGGTCATCATCCTTCCAACCAGCAGTCCAACGTGACCTCCCTGTTGTTGACGACGATGAGGATGAAGTA
GACAGCGAACATGCAAAGAAGCGTGTCGATACACCGGCCAATATCCATCGCCGAGACTTCGAATTCAAATTCACT
GTTGGCCGTCTACGTGGATCACTCTCCCGTTCTGACCCCCATGACCCGCAACGGGATCAGTTGCTGGTTGAACTG
GTTGCCGAAGGATTTGAGCTGGACTTTTATATGCGCCCCTATGACATGGTCGCTGAGGTTATTCTGAAATCTTTA
AGCGTAGATGATCACATCGAGGAGAATCCGGTTCCTGAATTCAAGAGAATCATCTCCTCTAAAGGCTTTGATGCC
GACGAAGACAAGGACCTGTTCCAGCTGAAGATGGTACGGGTTAAACCCGAGTCACCCGAGTTTGACTCAACGTAT
GAAGGGGTTGCCATGAACCTTGACATATCAGTCTCCACTATCAATCTTGTCGTGACAAGAAAAACACTTCTCACG
CTTCTAGACTTCACCCTCCTTACATTCACAAATCCTCAACAACCGACTCAACCCAACCCAGAAACAGACAAGGCT
ATTGAAGGGACCGCCAGTGTGGAAGAGAAGCCCGAGCAAGCTGGGAAAATCCGCATCAAGGCTAACCTCAAGAGT
ATTGCTCTCATCCTCAACAATGATGGAGTCCGCTTGGCAACTTTGAGTTTGAACACTGCCGACGTCGGGGTTTTC
CTCGTGGGCAGCTCGATGCTCATCCAGTCTCGGATAGGAAGTCTGACTTTGGTCGACGATGTCAACCTGGGTGCC
GCGGAGGACTCTGATATCCGACGCCTTCTGACCATAGAAGGAGATGATTTCGCGGACTTCAAGTACGAGACATTC
GATCCCGATAGTGAGACACACCCCGGTTATGATTCCGAGGTCTATCTGCGATCTGGTTCGATCAAGATCAATTTT
CTAGAGGAGCCCTACCGGAAGATCATCCACTTCCTCGTCAAGTTTGGCAAGATGCAAGCCATTTTCAATGCAGCT
CGCCAAGCCGCTGCCAGCCAGGCCAACCAACTCCAGGAGAATGCTTCACGTGTGCGGCTTGACATTATTGTGAAG
ACGCCCATTGTAGTTTTCCCTCGCGTTATGACGGACGGTCGCCCTCGAGACACAATCACCGCTCACCTCGGTGAA
ATTTATGCTAAGAATGAATTTGTCCCTATGGATGATGGAAAGGACAGCCCTGCTGTCAACGTCATCTCGACTGGT
GTCCGCAATATTCGCCTGACATCCAACTTCCATTTCGAAGATGGTACATCCGAGGAGCTGGAGATGATTCAGAAG
GTGAACTTGGAGTTCAGCATCTGCTATTTGGAGCATCAAGCAAACAACCCACGCCCAGATATGGAAATCGAGGGT
TCTCTATCTCCAATTAACCTCCGTATCTCCCAGAGCCAGCTCAAGTTCTTGCTGGAACTGTCAAAGTCGATACCG
AACGCGTTTGCCACAGATACCGAACAGCAAGAGCTCGAGGCTATGGAGTCGTTGCCCTCGTCGGTGACTGAACCT
ACTAGGGAGGCTAGTTCAAAGGCCGTCCAAGCACAAAATGGCTCGGGAGGAGCATTCCCTGATGACGAAAACAGA
GAGACTTGGGTACGACTTGATATGATCTTTAAGGTCGACAGTGTCGGCCTGGAGCTTATCCTGGCAAACGACGAC
CAGCCCGTCGGCCGCCTAGAGGACTCCAGTCTGTCCAAGTTCTCTCTCAATGATACTCGAGTCAAGCTGCGTATG
TTGACAGATGGCTCATTGGAGTCGGAGCTCCTCATTCATTCATTCTCCATCCGCGATAGTCGCAAGCAGGACTCG
AACAAGTTTAGAAACATCATGTCTTTGATCAACAACGATGTCCAACAGCAGTTCATGGCTAGCGTGTCCATGTCT
GGAGGACCAGAGAAGCACCTCATTGCGATGCTGACTATTGATAGCCCTCGCATTATGTTTGCTTTAGATTATCTG
TCTGCTTTACAGTCATTCAGCCAGTCTGCATTTGCCTCTGAAGGACCAATAGAGGTGCAGGATGAGAGCGAATCA
CCCGAGGAGTCTGAGTCAGGGTCCGATACTATTGTAAGTTCCAACAAGGCTATAACCGAGGCTTCTTCGGGCGAT
GCCACAGCAGCGGCTATGACCGTTTCATTCCGGGTCAATCTTGTCGACGCTCAGGTGATTATGGTGGCCAACCCT
GCCATTCCTCACTCTGAAGCTATCGTCCTTGGTACCAAGGAAGTTCTCATCTCCCACCAAAATGTGTCGACTCTG
CAGATTCAAAAAGTGGGCATGTTCCTGTGCCGCATGGATAAGTTTGAGACGTCTCGACTCCGCATTCTGGATGAT
TTCACTCTTGAAATGTCCATTGATAGCCGATCGCAAGATAAGGGATCTGCTTTGACCTCCATTGAGGTGCACCTT
GAGCCTTTGGTTCTTCGCTTGTCTCTGCGTGATATTCTGATGGCAATCCAGATTGTCAACAAGGCCTCTGAAATG
ACCCAGAATGCCCAGCAGACTGAGAGCGGAGAGGCGAAGAAAATTACGGACACGAAGACAACCAGAGGGCGTTCT
TCTAGCAAGACATCCTCTGCCGTTGTTAAGAGATCCAACCGCCCGAGTCAAGGAGCTGGAAACCTGGATCGGACA
ACTGCGCCACAAAGTTCAGTTGTCCTCAAGCGCGAAGAGATGTCTGCCAAGATCGACGGAGTTAGAGTCATTCTT
ATTGGTGATCTACACGATCTACCTTTGGTCGATTGGAGCGTCAAGAAATTCAACATCGATGTACGCGACTGGTCA
TCGACACTGAATGCCGATACCAACTTCGAAACGTTCATGAATGTGTATAACTTCTCGAAGTCGGCCTGGGAGCCG
TTGATTGAGCCCTGGCAGCTAGGATTCCACATGGCCAAGGAGACCAACCCGGATGTTTTCTCTTTCGATGTGTAT
TCGCACAAGACAATGGAGCTTACTATAACATCCGCCACGATTGCACTCGCATCCAAATCCTTCCAGTTCCTTTCT
ACTGATCAGGATGTCCTCGCCAAGCCAAGAGGCGCTGATGCCCCATACAGAATCCGCAACTACACTGGGTTTGAC
CTCAGTGTTTGGGCCGATGTCAGCGAAGGAGTGGAAGGCCCGGCGGCGAAACTTACCGACGGCGAAGAAGCCCCA
TGGCGATTTGAAGATTCCACCGCTATCCGTGAATCGCTGACCCCAGAAGGCCACGGCGGAGTGGTTGGTGTCAAA
CTGGAAGGCAGTGGCTTCGATAGTATCAGCCGCATTCCTGTCGTGCGTGAGGGCGAGGTTATCTACGCTCTGAAG
CCGAAGCAACAAAGTGTTCTTCACCGGCTACTCGTGGAAGTCAAACTGGGACCCGATAATGTCAAGTACATCACA
TTCCGTTCGCCACTTCTTATCGAGAACAATACCCAAATTCCCGTGGAAATGGGCATTTTCAGCCCCGGAGAAGGC
CACTTGCTGAAGATTGAGAAGATTTTGCCTGGGGACGCACGACCGGCACCCGTTGGATCAGCATATCTCCATTCT
ATCGTTGTTCGTCCCGATCAGGGCTTCGGATATGACTGGTCAGATGAGCGATTGTTCTGGAAGGACCTCATCAAG
CGACCTACACGCACGGTTAAGTGCATTAGCGAAAATGGACAGCAGGCTCCTCCTTTCTATTTCCAAGTCAACGCA
ACGTTTGATAGCAAGGATTCGCTTACGAGCGTGTATCCCTACATGAGGATCCGAATCTTCGCTCCCGTGGAGATT
CAGAACCTGTTGCCCTACGATTTCAAGTACCGCATCTACGACAAGAACACCAAGAAGGATTGGACGAACTTCTTG
AGGAAGGGTGGCGTCAGCCCGGTTCACGTCGTGGAGCTTTCCCACTTGCTGTTGCTCAGCATTGATCTGCAAGAT
TCGGTCTTCCGCCAGAGCGAATTTGCTATTGTCAACGGCAATGCCCAAGACTACCGCAGAGAGCATACCTTGACT
CTTAAGGATGAGCGAGGTCTTCAACTGAGGTTACAGCTTCATTACTTCAACATTCCTAACAGTGGTGGTGCTTTC
AAGGTTTCTGTGTACAGCCCATACCTTGTCTTGAACAAGACTGGCCTTCCTATGGACATTCAAAGCAAAGCATTC
CTCCAATCTGCGAGAAATGCCGCTGGTCAAGGACTCAGAGCCGATCCAAGAGACGAGGGCCGCGCACTTCCATAC
ATGTACTCTTATGCCAACGAGGACCAAAGCAACCGATCTATCTTGAAGGTCAGCGATTCTGCATGGAGTAAGCCG
CAGAGTTTCGAGGCTATTGGTAGTACCTTTGAGGTCATCTTCCCAGATCGCCAAGGCCGATCTGAGTTCCACTCC
GGAGTGTCTGTTGCTGAAGGCGAGGGCAAGTACAAGATGACCAAGGTGGTCACTCTTGCTCCACGGTTCATCCTA
AAGAGCAAGCTCAACGAAGATCTTCTGGCTCGCGAGCCAGGCTCCTCCAACGTACTCCAGGTCAAAAACGGGCAG
TTGGTACCGCTTCATTTCCTTCGTCAAGTTCAAGAGAAACAGCTGTGCCTCTGCTTCCCGGGCGTCAACAACCAA
TGGTCTTCCCCGTTCAACATCGCCGATGTGGGAACCGTGCACGTGAAATTGGCCAAGGCGAACCAGCGGCAGAAG
TTGATCAAGATTGATATCATCATGGAAGGAGCAACTCTTTTCTTGCACTTCAGCCTTGAGCAACGCAATTGGCCG
TTCTCCATGCGTAACGAAAGCGATATGGAGTTCATTTTCTACCAAGCCAATCCAAATGTGGAAGATGATGATGAA
GAAGACCAGACTAGCGGCTGGAGGCCGATCCGGTATCGGATTCCCGCGCGGAGCATCATGCCGTATGCATGGGAC
TACCCGGCGACGAAGAACAAGTCGCTCGTGTTGACCTGCCAGGGCAAAGAGCGCCATATCAAACTTGCCGAGATA
GGAAACCTGATCCCAATGCGGATTCCAGCTTCGCAGCCTGGCGAACACCAGAAGATCATTGACATCAACATTGCT
GCTGATGGCCCCACCCAGACTCTTGTGCTATCCAACTTCAAACCGTCGAAGAGTATGTACAAGCAACAAAGTAGA
CAATCCTCCCAGGTCGGCTCCACGGCTGGGTTCGAGATCAAGGAAATGAATTCGGACGTCAACTTCAAGGCCCAA
CTTCGCCTAGGTGGCATTGGAATTTCATTGATCAACCAGAACCTGAAAGAGCTGCTGTATCTCACATTCCGCGAG
ATTGAGTTCAAGTTCAGGGAATCGAGGTTGTACCAGACTCTGAACGCAACTATCAAATGGATCCAGATCGACAAC
CAGCTCTACGGTGGTATTTTCCCCATCTTGCTTTACCCCAGTGTCGTTCCGAAGACTGGCAAGGAGATGGAAGCA
CACCCGATCTTCCATGCAATGGTTACACGGGTTAAGGACGACTCGTATGGTGTTCTGTATATCAAGTACGCGACC
TTGCTATTGCAGCAAATGACACTTGAACTGGATGAGGACTTCGTCCTTGCCATGCTTGACTTTGTCAAGATTCCG
GGTGCTTCGTGGGCCGAGGAGCAAGAGGGCAAACTGTGCGATGAAGACCTCAACATTCCAGAGCCGCGACAAGAA
GACAATGGTCAGGATGTGTACTTCGAGCTCTTGCATCTCCAGCCAATGCAGATGGATATTTCATTCATGCGCACC
GAGCGCGTCAATGTGGAAGATACTATGCAGCCCTCCAACCCGTTGATGTTCTTTGTCAACGTCATGACAATGTCG
ATGGGTAATGTCAATGATGCACCAGTCCGACTCAATGCTCTGATGCTCGAGAATGCCCGTGTCTCTTTCCCCAGC
CTGGTCGCCAATATCCGTGCACACTATACCCAAGAATTCCTGGGCCAGATCCATATCATTCTCGGTTCGGCCGAC
TTCCTAGGCAACCCTGTCGGTTTGTTCAACAATGTCAGCTCTGGTGTCGCCGCTATCTTCTATGAGCCATATCAG
GGTTTGGTCATGACCGACCGTCCCCAAGAGCTGGGTCTTGGTATCGCAAAGGGTGCTACCAGCTTCATGAAGAAG
TCCATCTTCGGATTCTCGGACAGTATGGCCAAGCTTACGGGAAGTATGTCCAAGGGTCTCGCCGCCGCTACACTT
GATAAGGAGTTCCAAAACCAGCGCCGAATGTCCAAGGTGCGCAACCGCCCCAAGCACGCGCTGTATGGAATCACG
GCTGGTGGCAGTGCCTTTGCAACTAGTCTTGCAAGCGGTATCGGTGGCTTGGCACGTCATCCACTGCAAGGTGCG
GAGAAAGAAGGTATCCAAGGATTCTTCAAAGGTGTTGGAAAGGGTGTCCTTGGATTGGCTACCAAGCCAGCGATC
GGTGCATTCGATCTTGCCTCTAGTAAGTTGAACCATCCCCTTTCTCTAGTATTCATCACTAACAATCCCCTACTA
GATTTGGCAGAAGGTGTTCGCAACACCACTACTGTTTTCGATGCTGAAGGTCTCGACCGTGTTCGACTCACCCGC
TTTATTGGCACCGATGGCATTGTGCGCCCGTACTCGCAGCGCGAAGCTCTCGGACAGTTCTGGCTGAAGACCACG
GACGACGGCAAATACTTCGACGAAGACTACATTGCCCACCTAGAGCTGCCTGGCCGAGACATGCTGGTCTTGTTG
ACGTACGCACGTATCATGCTGGTGCGCACGAAGAAGCTGTATACTGAGTGGGATATCCGCCTCACGGATATCCAG
ACCATTTCCAAGGAGCGCACGGGAATGAGTATCACGCTCAAGGGTGGTGCCAACGGACCTTTCATTCCTGTCCAA
GATGAAAGCTCGCGGAACTGGCTCTATAGACAGATTGCTGTCGGTAAGTAGTTACTCTGATCATGCTAAACAATG
TCATTTGCTAACCAAATACCCTTTCCAGCGGTCAATGCTTTCAACGAGAAGTATAATTCCAGGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail