Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3682.t1
Gene name
Locationscaffold_06:419331..421039
Strand-
Gene length (bp)1708
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 8.1E-126 35 514
PF00571 CBS CBS domain 6.0E-06 123 169
PF00571 CBS CBS domain 3.8E-09 179 234
PF01070 FMN_dh FMN-dependent dehydrogenase 4.7E-06 274 390

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 162.42 98.28 226.56
5d_25C Five days - 25 degrees Celsius 232.65 136.44 328.85
7d_25C Seven days - 25 degrees Celsius 253.60 149.04 358.15
10d_25C Ten days - 25 degrees Celsius 285.83 167.18 404.48
7d_15C Seven days - 15 degrees Celsius 294.89 168.04 421.74
7d_30C Seven days - 30 degrees Celsius 277.49 163.14 391.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.116163 no
3d_25C 7d_25C 0.042422 yes
3d_25C 7d_15C 0.006000 yes
3d_25C 7d_30C 0.008807 yes
3d_25C 10d_25C 0.004840 yes
5d_25C 7d_25C 0.783524 no
5d_25C 7d_15C 0.362545 no
5d_25C 7d_30C 0.517733 no
5d_25C 10d_25C 0.429975 no
7d_25C 7d_15C 0.605478 no
7d_25C 7d_30C 0.774279 no
7d_25C 10d_25C 0.687640 no
7d_15C 7d_30C 0.860403 no
7d_15C 10d_25C 0.931377 no
7d_30C 10d_25C 0.933829 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3682.t1
MVEILDYTKALEVLKEYPGDGLHVDTLLDSDSHGALTYNDFLILPGSITFPASDVSLETRVTRRFTIKAPLLSSP
MDTVTEHSMAIHMALLGGLGVIHNNCPPDEQAEMVRKVKRYENGFIQDPIVLSPETTVGEAKELKTKWGFGGFPV
TEKGTLHSKLLGIVTSRDIQFHKNHEDPVTAVMATDLVTAPAGTTLAEANEVLRSSKKGKLPIVDKDGSLISLLS
RSDLMKNIHYPLASKLPSKQLLCAAAISTHDADKVRLQKLVDAGLDIVVVDSSQGHSTFQIAMIKYIKQNFPDID
VIGGNIVTREQAAALIAAGADGLRIGMGSGSACITQEVMAAGRPQAAAVRSVSAFAARFGVPTIADGGVQNLGHI
VKGLALGASAVMMGSLLAGTTESPGEYFMSSEGQLVKAFRGMGSIAVMEDKSKSGAGNNAGASRYFSENDKVKVA
QGVAGSVIDRGSITQYVPYLVAGVQHSLQDIGVQNLDALREGVNNGTVRFEMRSASAQTEGNVHGLHTHEKKLYS
S*
Coding >Pro_DTO377G3_2|g3682.t1
ATGGTCGAAATTCTGGATTATACCAAGGCTTTAGAAGTACTCAAGGAGTATCCTGGAGATGGCCTCCACGTCGAT
ACTCTCCTCGATTCGGATAGTCATGGAGCTTTGACTTACAATGACTTCCTGATTTTGCCCGGTTCTATCACCTTC
CCGGCATCGGATGTTTCGTTGGAAACCAGAGTAACCCGGCGGTTCACCATCAAGGCCCCTCTACTGTCTTCTCCC
ATGGACACTGTGACCGAACACAGCATGGCCATCCATATGGCTCTCCTGGGGGGTCTGGGTGTTATCCACAATAAC
TGCCCACCTGACGAGCAGGCTGAGATGGTGAGGAAGGTGAAACGCTATGAGAATGGCTTCATCCAGGACCCTATC
GTTCTGTCTCCGGAGACGACAGTTGGAGAAGCAAAGGAATTGAAGACTAAATGGGGATTCGGCGGGTTCCCAGTG
ACTGAAAAGGGAACCCTCCACTCGAAGCTTCTCGGAATCGTCACCAGCCGAGATATCCAGTTCCACAAGAACCAC
GAGGATCCAGTCACGGCTGTCATGGCGACAGACCTCGTCACCGCACCGGCAGGCACTACTCTCGCCGAAGCCAAC
GAAGTCCTCCGGAGTTCGAAGAAGGGTAAACTGCCAATTGTGGATAAGGATGGATCCCTGATCTCCCTGCTCTCC
CGGAGTGACTTGATGAAGAACATTCATTACCCTCTTGCATCAAAGCTTCCATCCAAGCAGCTGCTCTGCGCCGCG
GCCATTAGCACTCACGACGCGGATAAGGTCCGTCTCCAGAAGCTCGTCGATGCCGGTCTGGACATTGTCGTCGTG
GATAGTAGCCAGGGCCACAGCACTTTCCAAATTGCTATGATCAAATATATCAAGCAGAACTTCCCCGACATTGAC
GTTATCGGCGGTAATATTGTTACCCGTGAGCAAGCCGCGGCATTGATCGCTGCTGGTGCAGACGGTCTTCGTATC
GGCATGGGCAGTGGCTCTGCGTGTATCACGCAGGAAGTCATGGCCGCTGGTCGTCCTCAGGCTGCAGCCGTACGC
AGTGTATCTGCCTTCGCCGCGCGTTTCGGTGTTCCCACTATTGCTGACGGTGGTGTCCAGAACCTGGGCCACATC
GTCAAGGGACTTGCCTTGGGTGCCTCGGCAGTTATGATGGGAAGTCTGCTTGCTGGCACTACCGAGTCTCCTGGT
GAGTACTTTATGAGCAGTGAAGGCCAGTTGGTCAAGGCTTTCCGTGGTATGGGCAGTATTGCGGTCATGGAGGAC
AAAAGCAAGAGCGGCGCTGGGAACAACGCCGGTGCTTCTCGGTACTTCTCTGAGAATGATAAGGTCAAGGTTGCG
CAGGGTGTTGCGGGCTCCGTTATTGATCGTGGCTCTATCACCCAGTATGTCCCTTACCTTGTTGCTGGTGTGCAG
CATTCTCTCCAGGATATTGGTGTCCAGAACCTTGATGCCTTGCGTGAAGGGGTGAACAATGGAACAGTTCGCTTT
GAGATGAGAAGCGCTAGCGCGCAGACCGAGGGTAATGTCCACGGCTTGCACACCCACGAGAAGAAGTTGTACTCT
TCTTGA
Transcript >Pro_DTO377G3_2|g3682.t1
ATGGTCGAAATTCTGGATTATACCAAGGCTTTAGAAGTACTCAAGGAGTATCCTGGAGATGGCCTCCACGTCGAT
ACTCTCCTCGATTCGGATAGTCATGGAGCTTTGACTTACAATGACTTCCTGATTTTGCCCGGTTCTATCACCTTC
CCGGCATCGGATGTTTCGTTGGAAACCAGAGTAACCCGGCGGTTCACCATCAAGGCCCCTCTACTGTCTTCTCCC
ATGGACACTGTGACCGAACACAGCATGGCCATCCATATGGCTCTCCTGGGGGGTCTGGGTGTTATCCACAATAAC
TGCCCACCTGACGAGCAGGCTGAGATGGTGAGGAAGGTGAAACGCTATGAGAATGGCTTCATCCAGGACCCTATC
GTTCTGTCTCCGGAGACGACAGTTGGAGAAGCAAAGGAATTGAAGACTAAATGGGGATTCGGCGGGTTCCCAGTG
ACTGAAAAGGGAACCCTCCACTCGAAGCTTCTCGGAATCGTCACCAGCCGAGATATCCAGTTCCACAAGAACCAC
GAGGATCCAGTCACGGCTGTCATGGCGACAGACCTCGTCACCGCACCGGCAGGCACTACTCTCGCCGAAGCCAAC
GAAGTCCTCCGGAGTTCGAAGAAGGGTAAACTGCCAATTGTGGATAAGGATGGATCCCTGATCTCCCTGCTCTCC
CGGAGTGACTTGATGAAGAACATTCATTACCCTCTTGCATCAAAGCTTCCATCCAAGCAGCTGCTCTGCGCCGCG
GCCATTAGCACTCACGACGCGGATAAGGTCCGTCTCCAGAAGCTCGTCGATGCCGGTCTGGACATTGTCGTCGTG
GATAGTAGCCAGGGCCACAGCACTTTCCAAATTGCTATGATCAAATATATCAAGCAGAACTTCCCCGACATTGAC
GTTATCGGCGGTAATATTGTTACCCGTGAGCAAGCCGCGGCATTGATCGCTGCTGGTGCAGACGGTCTTCGTATC
GGCATGGGCAGTGGCTCTGCGTGTATCACGCAGGAAGTCATGGCCGCTGGTCGTCCTCAGGCTGCAGCCGTACGC
AGTGTATCTGCCTTCGCCGCGCGTTTCGGTGTTCCCACTATTGCTGACGGTGGTGTCCAGAACCTGGGCCACATC
GTCAAGGGACTTGCCTTGGGTGCCTCGGCAGTTATGATGGGAAGTCTGCTTGCTGGCACTACCGAGTCTCCTGGT
GAGTACTTTATGAGCAGTGAAGGCCAGTTGGTCAAGGCTTTCCGTGGTATGGGCAGTATTGCGGTCATGGAGGAC
AAAAGCAAGAGCGGCGCTGGGAACAACGCCGGTGCTTCTCGGTACTTCTCTGAGAATGATAAGGTCAAGGTTGCG
CAGGGTGTTGCGGGCTCCGTTATTGATCGTGGCTCTATCACCCAGTATGTCCCTTACCTTGTTGCTGGTGTGCAG
CATTCTCTCCAGGATATTGGTGTCCAGAACCTTGATGCCTTGCGTGAAGGGGTGAACAATGGAACAGTTCGCTTT
GAGATGAGAAGCGCTAGCGCGCAGACCGAGGGTAATGTCCACGGCTTGCACACCCACGAGAAGAAGTTGTACTCT
TCTTGA
Gene >Pro_DTO377G3_2|g3682.t1
ATGGTCGAAATTCTGGATTATACCAAGGCTTTAGAAGTACTCAAGGAGTATCCTGGAGATGGCCTCCACGTCGAT
ACTCTCCTCGATTCGGATAGTCATGGAGCTTTGACTTACAATGACTTCCTGATTTTGCCCGGTTCTATCAGTAAG
GCAATGAACATTATCTCATAGGTCGTTCTCTCTAATCGTACGAACAGCCTTCCCGGCATCGGATGTTTCGTTGGA
AACCAGAGTAACCCGGCGGTTCACCATCAAGGCCCCTCTACTGTCTTCTCCCATGGACACTGTGACCGAACACAG
CATGGCCATCCATATGGCTCTCCTGGGGGGTCTGGGTGTTATCCACAATAACTGCCCACCTGACGAGCAGGCTGA
GATGGTGAGGAAGGTGAAACGCTATGAGAATGGCTTCATCCAGGACCCTATCGTTCTGTCTCCGGAGACGACAGT
TGGAGAAGCAAAGGAATTGAAGACTAAATGGGGATTCGGCGGGTTCCCAGTGACTGGTTAGTTGGATTTCTCCTT
GGTGGCTCTTTTTCTTTTTGTTTCGTTTGGTGATCCTTACCTTGTTTCGTTCATAGAAAAGGGAACCCTCCACTC
GAAGCTTCTCGGAATCGTCACCAGCCGAGATATCCAGTTCCACAAGAACCACGAGGATCCAGTCACGGCTGTCAT
GGCGACAGACCTCGTCACCGCACCGGCAGGCACTACTCTCGCCGAAGCCAACGAAGTCCTCCGGAGTTCGAAGAA
GGGTAAACTGCCAATTGTGGATAAGGATGGATCCCTGATCTCCCTGCTCTCCCGGAGTGACTTGATGAAGAACAT
TCATTACCCTCTTGCATCAAAGCTTCCATCCAAGCAGCTGCTCTGCGCCGCGGCCATTAGCACTCACGACGCGGA
TAAGGTCCGTCTCCAGAAGCTCGTCGATGCCGGTCTGGACATTGTCGTCGTGGATAGTAGCCAGGGCCACAGCAC
TTTCCAAATTGCTATGATCAAATATATCAAGCAGAACTTCCCCGACATTGACGTTATCGGCGGTAATATTGTTAC
CCGTGAGCAAGCCGCGGCATTGATCGCTGCTGGTGCAGACGGTCTTCGTATCGGCATGGGCAGTGGCTCTGCGTG
TATCACGCAGGAAGTCATGGCCGCTGGTCGTCCTCAGGCTGCAGCCGTACGCAGTGTATCTGCCTTCGCCGCGCG
TTTCGGTGTTCCCACTATTGCTGACGGTGGTGTCCAGAACCTGGGCCACATCGTCAAGGGACTTGCCTTGGGTGC
CTCGGCAGTTATGATGGGAAGTCTGCTTGCTGGCACTACCGAGTCTCCTGGTGAGTACTTTATGAGCAGTGAAGG
CCAGTTGGTCAAGGCTTTCCGTGGTATGGGCAGTATTGCGGTCATGGAGGACAAAAGCAAGAGCGGCGCTGGGAA
CAACGCCGGTGCTTCTCGGTACTTCTCTGAGAATGATAAGGTCAAGGTTGCGCAGGGTGTTGCGGGCTCCGTTAT
TGATCGTGGCTCTATCACCCAGTATGTCCCTTACCTTGTTGCTGGTGTGCAGCATTCTCTCCAGGATATTGGTGT
CCAGAACCTTGATGCCTTGCGTGAAGGGGTGAACAATGGAACAGTTCGCTTTGAGATGAGAAGCGCTAGCGCGCA
GACCGAGGGTAATGTCCACGGCTTGCACACCCACGAGAAGAAGTTGTACTCTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail