Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3680.t1
Gene name
Locationscaffold_06:405933..413690
Strand-
Gene length (bp)7757
Transcript length (bp)7476
Coding sequence length (bp)7476
Protein length (aa) 2492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 7.4E-76 404 646
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.2E-36 654 770
PF14765 PS-DH Polyketide synthase dehydratase 5.5E-28 1335 1609
PF00698 Acyl_transf_1 Acyl transferase domain 4.0E-18 981 1199
PF08242 Methyltransf_12 Methyltransferase domain 4.7E-19 1958 2061
PF18558 HTH_51 Helix-turn-helix domain 6.0E-18 1777 1852
PF13489 Methyltransf_23 Methyltransferase domain 1.2E-11 1939 2112
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 1.3E-10 86 259
PF00550 PP-binding Phosphopantetheine attachment site 5.3E-12 1656 1721
PF13649 Methyltransf_25 Methyltransferase domain 4.7E-11 1957 2059
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 4.0E-09 2182 2300
PF08241 Methyltransf_11 Methyltransferase domain 2.4E-09 1958 2062
PF00326 Peptidase_S9 Prolyl oligopeptidase family 2.8E-07 2394 2483
PF13847 Methyltransf_31 Methyltransferase domain 7.1E-09 1954 2066
PF02636 Methyltransf_28 Putative S-adenosyl-L-methionine-dependent methyltransferase 1.5E-06 1938 2006

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008236 serine-type peptidase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008233 peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3680.t1
MSLNTEHSKGDLRLLFGPQCSEIEDSIAHIRDAVYKDSAGLGFLSDILDELPSLWPVITSAWPALRKVQGEKQLA
ALGRRFENGSPDSEAEPSSLIMTPVTVMKHLVDFWNLQNVATHPAFPSSPLSRTTAPRIIDSQGFCVGILAAIAV
ACSQDTREFQSLASNAIRLAVCIGALVDFDEIVSGKAKSIAVRWETPADHDYLEQTLTKSPNVYISCYTDVNSVT
ITIPGDTAQRVKFKQELSGRGLHTKPIPLQGRFHHQQTHREGIQHIMNLCVKDPRFQLPHSNALILPLRSSHNGQ
VLINAAMLHTVALESILSVKADWWGTVSALLNSADMEVDESRLLSIGQEEFVPRSARGRLVARSNLDVYGAGVFA
NGNTSARSAVSLQNGTNTLNGSPQAAEMPPIAITGMACRYSNADTTSELWDLLELGVCTVEKAPGNRFRMPDLQR
EPKGPFWGHFLDRPDAFDHRFFNISAREAESMDPQQRVLLQVAYEAMESAGYCGWQHTELSDEIGCYVGVGSEDY
TENVASRNANAFSATGTLQSFIAGRISHHFGWSGPSITLDTACSSAAVAIHMACKALQTKECSIAVAGGVNILTN
PRVYQNLAAASFLSSTGACKSFDVSADGYCRGEGAGLVVLRPLQDAIDNGDPILGVIAGSVVNQGSNRSPITVPD
AESQRSLYRKALSLAGVAPDEVTYVEAHGTGTQVGDPIELESLRKAFGNPLRSQSLHVGSIKGNIGHTETSSGVA
GLLKTILMLQKQRIPKQANFRQLNPKVMPPLENDRLVIPVESTKWASARRVAMVSNYGASGSNAALIVRDHTPSL
SGQGKAMAEYIRDMPILISARSEESIRAYCGALRTTLLRHPYSNTVVRELAYNVAMKQNRTLPFTLTFSTSSDPT
SLSTRLEAIAAGKSADIIQKRESNEPPIVLCFGGQNGVTSSISQELYDSCVLLQTHLMACEQAGQKLGLPSLFPT
IFTSDPIVNTVYLHFMLFSIQYASARAWIDSGLRVDRIVGHSFGQLTALSVAGSLSVQEGIRLVTERARLIQSNW
GPESGVMLAVEGTQAEVQRVLEQTGHRAEIACYNGPQQQVLAGTGECIRAVEDALATNPLTSNVRVRRLENSHAF
HSRLVDSIVPGLTELAESFVYQAPAIPIEACSATGDWSIVTPAKIVEHSRMPVHFQRAVERIAQKLQVPAVWLEA
GSASPIIPMVRRVLEKSSATHTYHRVNLDGSDGSGNLATVTSALWGQGVHVQFWPFHHSQRGTFGWMNLPPYQFA
KNRHWVDFDPTAFSFSGSSAEPQCGSQERAGLLRKLSDGPEEYLFAVNTQDVLYRSCTKGHAVLDQTLCPASMYM
EMVLRAATSVFTLGESSTLTMSHIEDLVISSPLVLDPQGSVFVRLIPEAVASSQTWSFSIFSSSGTGNESSIHAT
GSVSLCNERSRALSHFQSMNRLMDPARARGIEDHLASNGLKGSTVYSALEQVTNYADYFRGVRQVFANGREAAGL
VSMAPSATETTCNPILLDNFLQVAGIHVNCLSGREAEEVFVCNAIGETYVSDSLFKKEDGAIPLSWKVYTNYVRP
SKNEIVCDIYVMNSQGDGLTAAIMGVRFMSVSIRSLTRALAKLNNNFPDVPQLPPTIQPAIVTADYDEASDNVNV
DSDLVAVQEMLCELFGVSVEEVSPSVSLIDIGVDSLISTEVLSEIKRRFHKDISYSTLVDIPNIQGLTEHIFPGH
SHLAPSQIVIKPVRQQTVIPQTVTSLPVPANAGPSLVSVAHQCFYETHAAVSHTHNADWAGFFNAIYPQQMTLIT
AYILEAFRALGSPLESSQADEVLPIISVLPRHEQLKKHLYTILESVNLVRQTPTGQLVRTATPISPLSSHALHAQ
IRDEHPPYALEHDLLQITGSRLAECLTGQADGVSLIFQDSQTRRLVGDVYTDSPVFKSGNLYLAQYLTDVIQTLG
NGRQVKILEIGAGTGGTTKNLLEQLSALPGMATRMEYTFTDISPSLVAAARKKFSKYDFVRYETINVESSPPSLL
HGQYDIVLSTNCVHATRNLVESCSNIRKLLRPDGILCLVELTRDIFWLDLVFGLLEGWWRFEDGRKHALATEDLW
DQTLRQSGFEWVGWTNNEAVESNALRVIVASPTKAPSALEICSKPANMETVVWGERNGLQLLADIFYPDVVDTTQ
KRRACALMVHGGGHVMLSRKDIRPAQTQTLLDAGFLPISVDYRLCPEVSLSEGPMADVRDALGWVRRILPNIPLL
RPDIRPDGNQVVAIGWSTGGHLAMTLAFTAPAVGIAAPEAILAFYCPTDYEDPFWSRPNFPFGQTVASNDIEYDV
WEGVQSAPIKGYNPAFKERPLGGWMSTSDPRSRIALHMNWTGQTLPVLLGGMHKEFRIPDELPRPTDEEIQAVSP
NYQIRIGRYRTPTFMVHGTSDDLVPCAQTESTYNALTQNGIEADIRVVQGAVHLFDLYPSSHAGQNAKEAVADGY
EFLKRHIHSKGYSDKD*
Coding >Pro_DTO377G3_2|g3680.t1
ATGTCATTGAATACAGAGCATTCAAAAGGAGACCTTCGTCTTCTCTTCGGACCACAATGCTCTGAAATTGAAGAC
TCCATCGCCCACATCCGGGATGCCGTATACAAAGATTCAGCCGGTCTGGGGTTCTTATCTGATATTCTTGACGAG
CTTCCCTCCTTATGGCCCGTCATAACTTCTGCCTGGCCAGCCCTACGGAAGGTGCAGGGGGAGAAGCAACTAGCT
GCACTGGGGCGGCGTTTTGAGAATGGATCTCCAGATAGTGAAGCAGAACCCTCAAGTCTCATCATGACTCCAGTC
ACGGTGATGAAACATCTAGTTGACTTTTGGAATCTCCAAAACGTTGCGACACATCCGGCGTTTCCATCCTCGCCA
TTATCACGGACCACAGCCCCAAGGATAATCGACTCACAGGGGTTCTGTGTGGGTATTCTGGCGGCAATTGCTGTG
GCCTGCTCCCAGGATACACGGGAATTCCAGTCTTTGGCTTCGAACGCCATACGGCTCGCTGTCTGTATTGGGGCG
TTGGTGGACTTCGATGAGATCGTGTCGGGTAAGGCTAAGTCAATTGCAGTGCGGTGGGAGACCCCAGCGGACCAT
GACTATCTTGAACAGACCTTGACAAAAAGTCCCAATGTTTATATCTCCTGCTATACAGACGTTAACAGCGTCACT
ATCACTATCCCCGGTGACACTGCACAACGGGTCAAATTCAAACAGGAGCTTAGCGGCCGTGGTCTTCACACAAAG
CCGATCCCCCTCCAAGGCCGCTTCCACCACCAGCAAACACACCGCGAAGGCATCCAGCACATAATGAATCTATGT
GTGAAGGATCCTCGCTTTCAACTCCCTCACAGCAACGCGTTGATATTACCCCTTCGATCAAGTCACAATGGGCAG
GTGCTCATAAATGCAGCCATGTTGCACACTGTTGCCTTGGAATCAATCCTCTCTGTCAAGGCAGACTGGTGGGGA
ACAGTCTCCGCATTACTAAACAGCGCCGATATGGAAGTTGACGAGTCCCGTCTTCTATCCATCGGCCAGGAAGAG
TTCGTCCCACGATCAGCTAGAGGCCGTCTGGTAGCCAGGAGCAACCTTGATGTCTACGGGGCAGGAGTGTTTGCT
AACGGTAACACGTCGGCTCGCTCCGCAGTGTCGCTGCAGAACGGCACGAACACCCTCAATGGTAGTCCACAGGCA
GCTGAGATGCCACCTATTGCCATTACTGGCATGGCTTGTAGATATTCTAACGCAGACACCACGAGCGAGCTATGG
GATTTGCTGGAGCTGGGGGTATGTACAGTGGAGAAGGCCCCTGGGAATCGGTTCCGGATGCCAGACTTGCAGCGG
GAGCCCAAGGGCCCATTTTGGGGTCACTTCCTCGACCGGCCAGATGCATTCGACCATCGTTTTTTTAACATCTCA
GCGCGAGAGGCCGAGTCCATGGATCCACAACAACGCGTGTTGCTGCAAGTAGCATATGAAGCCATGGAGTCTGCC
GGATACTGCGGATGGCAGCACACTGAGCTATCGGACGAAATTGGCTGCTATGTGGGAGTGGGATCTGAGGACTAT
ACTGAGAATGTGGCATCGCGGAATGCGAATGCCTTCTCAGCCACAGGAACCCTGCAGTCATTTATAGCTGGCCGT
ATCAGCCATCATTTCGGCTGGTCGGGCCCATCGATTACGCTAGATACAGCGTGTTCATCCGCAGCAGTGGCTATC
CATATGGCATGCAAGGCCCTGCAAACAAAGGAGTGCTCGATTGCCGTGGCTGGCGGTGTGAATATTCTGACAAAC
CCCAGGGTGTACCAGAACCTGGCTGCTGCTTCTTTCCTGTCATCTACGGGAGCATGTAAGTCGTTTGATGTCTCT
GCGGATGGATACTGCCGCGGAGAGGGCGCTGGACTCGTTGTCCTTCGGCCATTGCAGGATGCGATTGACAACGGC
GACCCTATCCTCGGCGTGATCGCTGGCTCAGTCGTCAACCAGGGCTCGAACAGGTCACCCATCACCGTCCCCGAT
GCAGAGTCTCAACGATCGCTGTATAGAAAAGCTTTGTCACTCGCTGGGGTTGCCCCGGATGAGGTCACCTATGTG
GAGGCCCATGGCACTGGCACACAAGTTGGAGATCCGATTGAACTGGAAAGCCTTCGCAAGGCATTTGGAAACCCG
CTCCGAAGTCAGAGTCTCCATGTTGGGTCCATCAAGGGTAACATCGGACACACTGAGACCTCCTCGGGGGTCGCC
GGGCTGTTGAAGACGATCCTCATGCTTCAGAAGCAACGAATACCGAAACAGGCAAACTTCAGGCAGTTGAATCCC
AAGGTCATGCCTCCACTCGAGAACGACCGATTGGTGATTCCCGTAGAGTCAACCAAATGGGCATCAGCGAGACGG
GTTGCTATGGTCAGCAATTACGGGGCATCGGGGAGCAACGCCGCGCTTATAGTGAGAGACCACACTCCTAGCCTA
TCGGGACAGGGGAAGGCAATGGCGGAATACATTCGAGATATGCCTATCTTGATTTCTGCACGGTCTGAAGAATCT
ATTCGGGCCTATTGCGGTGCCCTTCGCACCACCCTTTTGAGGCATCCGTATTCCAATACCGTCGTCCGGGAATTG
GCGTACAACGTCGCAATGAAGCAGAATCGAACACTGCCGTTTACTCTTACCTTTTCAACCTCTTCTGATCCGACA
TCACTGAGCACCCGCTTGGAGGCTATCGCCGCAGGCAAGTCTGCCGATATTATCCAGAAGCGGGAATCCAACGAG
CCCCCAATAGTTTTGTGTTTCGGCGGTCAGAATGGAGTTACTTCGAGCATTTCACAAGAACTTTACGACAGCTGT
GTCCTTTTACAGACGCACCTCATGGCGTGCGAGCAAGCAGGCCAGAAGCTCGGCCTTCCCAGTCTTTTCCCAACT
ATCTTCACATCAGACCCCATCGTGAATACCGTTTACCTGCACTTCATGCTCTTCTCTATACAGTACGCATCTGCC
AGAGCCTGGATCGACTCAGGACTGCGCGTAGACCGCATAGTGGGCCATAGCTTTGGTCAGCTCACTGCGCTATCC
GTGGCTGGCAGTTTGAGTGTTCAAGAAGGCATCCGCCTGGTTACTGAGCGTGCACGCCTGATCCAGTCCAACTGG
GGCCCGGAGTCAGGGGTGATGCTCGCTGTGGAGGGTACGCAGGCCGAGGTCCAGCGTGTGCTAGAGCAGACAGGC
CACCGTGCTGAAATTGCCTGCTATAATGGACCACAGCAGCAAGTGCTTGCCGGCACGGGGGAATGCATCCGAGCG
GTTGAAGACGCTCTCGCTACAAACCCATTGACAAGCAACGTCAGGGTCAGACGTTTGGAGAACTCGCATGCCTTC
CACTCTAGACTTGTTGATAGCATTGTGCCCGGCCTCACAGAGCTCGCAGAGTCCTTTGTCTACCAAGCACCAGCT
ATCCCCATCGAAGCCTGTTCGGCGACTGGCGACTGGTCGATTGTCACCCCGGCAAAGATCGTCGAGCACAGTCGC
ATGCCCGTGCACTTCCAACGCGCTGTCGAAAGAATAGCTCAAAAACTACAAGTTCCCGCTGTCTGGCTCGAAGCC
GGCTCAGCCTCGCCTATCATCCCCATGGTGCGTCGAGTGCTGGAGAAATCGTCCGCAACTCACACATACCATAGG
GTTAACCTCGATGGGTCGGACGGAAGCGGGAATTTGGCAACTGTCACCAGCGCCCTCTGGGGTCAGGGCGTCCAT
GTCCAGTTCTGGCCCTTCCATCACTCGCAGCGTGGGACCTTCGGCTGGATGAACCTTCCGCCGTATCAGTTCGCG
AAGAACAGACACTGGGTTGACTTTGACCCTACTGCTTTCTCGTTTTCCGGATCCTCCGCCGAACCGCAATGTGGC
AGTCAGGAGCGGGCTGGCCTGTTGCGCAAGTTGAGCGACGGCCCAGAGGAGTATCTATTTGCCGTTAACACCCAA
GATGTATTGTATAGGTCATGCACGAAGGGGCACGCGGTATTGGACCAAACATTGTGTCCCGCATCCATGTATATG
GAGATGGTCCTGCGGGCAGCAACTTCCGTATTCACCTTGGGTGAATCCTCAACGCTGACTATGTCTCATATCGAG
GACCTGGTGATATCATCCCCCTTAGTATTAGATCCGCAAGGAAGCGTGTTCGTACGACTGATCCCAGAGGCAGTG
GCTTCTTCCCAGACGTGGTCATTCTCGATATTTAGCAGTAGCGGGACGGGTAATGAGTCGTCGATTCATGCTACA
GGCAGTGTATCCTTATGCAATGAAAGGTCCAGGGCTCTGTCACACTTTCAGTCTATGAATCGGTTGATGGACCCG
GCACGGGCAAGAGGAATTGAGGATCATCTGGCATCAAACGGACTGAAAGGATCGACGGTTTACTCTGCCCTCGAA
CAGGTTACCAATTATGCAGACTACTTCCGCGGAGTGAGGCAGGTGTTTGCAAATGGCCGTGAGGCTGCGGGGCTG
GTCAGTATGGCACCGTCAGCCACCGAGACCACGTGCAACCCCATCCTCCTGGACAACTTTCTGCAAGTTGCGGGA
ATTCACGTCAACTGCCTCTCTGGCCGCGAAGCAGAGGAAGTATTCGTGTGCAATGCTATCGGGGAAACGTATGTT
AGCGATTCGTTGTTCAAAAAGGAAGACGGAGCTATTCCGTTATCATGGAAGGTATATACCAACTACGTCCGGCCG
TCCAAGAATGAGATCGTGTGCGATATCTACGTGATGAACTCTCAAGGAGACGGTCTTACCGCCGCAATTATGGGC
GTTCGGTTCATGAGTGTCTCCATCCGCTCTCTCACTCGCGCACTGGCCAAGCTGAACAACAATTTCCCTGACGTC
CCACAACTCCCGCCCACGATCCAGCCAGCAATTGTGACAGCCGATTATGATGAAGCCAGTGACAATGTAAATGTG
GATAGCGACCTTGTTGCAGTCCAAGAGATGCTTTGCGAGCTGTTTGGAGTTAGTGTCGAAGAGGTATCTCCATCA
GTCTCGCTGATAGATATCGGAGTGGACTCGCTCATAAGCACAGAAGTGCTCTCCGAGATCAAGAGGAGATTCCAT
AAGGATATTTCCTATTCCACCTTGGTGGATATTCCCAACATCCAGGGTTTGACAGAGCATATCTTCCCGGGACAT
TCTCACCTAGCTCCTTCCCAGATTGTGATCAAACCAGTACGGCAGCAGACAGTGATACCGCAAACTGTAACTTCT
CTGCCTGTGCCAGCTAACGCCGGACCGTCGCTAGTCTCAGTAGCACACCAATGCTTCTATGAGACTCACGCCGCG
GTATCCCACACACACAATGCCGACTGGGCCGGCTTCTTCAATGCCATCTATCCGCAACAAATGACACTCATCACG
GCGTACATCCTGGAAGCATTCCGCGCCTTGGGCTCCCCGCTAGAGTCCAGTCAGGCAGATGAGGTCCTTCCTATT
ATTTCCGTCCTACCTCGCCACGAGCAGTTGAAGAAGCACCTGTATACAATTTTGGAATCCGTCAACCTCGTGCGC
CAAACTCCAACTGGTCAACTCGTGCGCACAGCGACACCCATCTCGCCGCTCTCATCACACGCCTTGCATGCCCAG
ATCCGGGATGAACACCCTCCATATGCACTGGAGCACGATCTTCTACAGATCACAGGCTCGCGGTTGGCTGAGTGT
CTGACCGGGCAAGCGGACGGGGTATCGCTAATTTTCCAGGATTCCCAGACTCGGCGCCTGGTAGGAGATGTCTAT
ACGGACTCCCCGGTGTTCAAGTCGGGTAACCTCTACCTCGCACAGTATCTCACGGATGTCATTCAAACTCTCGGA
AACGGTCGGCAGGTTAAAATCCTCGAGATCGGGGCCGGCACAGGAGGCACTACCAAGAATCTCCTCGAGCAGCTC
TCGGCCCTCCCCGGAATGGCGACACGCATGGAGTATACATTCACGGATATCTCGCCATCGCTTGTTGCAGCCGCG
CGGAAGAAGTTTTCCAAGTATGATTTCGTACGGTACGAAACTATTAACGTGGAGAGTAGCCCTCCCTCGCTCTTG
CACGGCCAATACGACATTGTGTTGTCGACCAACTGCGTCCATGCTACCCGAAATCTCGTCGAGTCCTGCTCAAAT
ATCCGCAAGCTCCTCCGGCCTGATGGGATCTTGTGTCTCGTTGAGCTGACGCGTGACATATTCTGGTTGGATCTT
GTGTTCGGACTCCTGGAGGGCTGGTGGCGGTTTGAGGACGGTCGGAAGCACGCGCTGGCCACTGAAGATCTTTGG
GATCAGACGCTTCGCCAATCTGGCTTCGAGTGGGTGGGCTGGACGAATAATGAGGCTGTAGAGTCAAATGCTCTG
CGCGTTATTGTCGCATCGCCGACGAAGGCCCCTTCTGCTCTGGAGATTTGCTCCAAGCCGGCAAACATGGAAACT
GTTGTTTGGGGCGAAAGAAATGGTCTGCAGCTGCTGGCTGATATATTTTATCCCGACGTGGTTGACACCACGCAG
AAACGACGAGCATGTGCTCTGATGGTTCATGGAGGTGGCCACGTCATGCTATCTCGTAAAGACATCCGTCCTGCC
CAGACACAGACCCTTCTCGATGCCGGATTCCTGCCCATCAGTGTTGACTACCGCCTGTGCCCTGAGGTTAGCCTT
TCAGAAGGCCCTATGGCCGACGTGCGCGACGCCCTAGGTTGGGTGCGCCGCATCCTCCCAAATATCCCCTTGCTA
CGTCCAGATATCCGACCGGACGGCAACCAGGTTGTGGCTATCGGGTGGTCCACTGGTGGTCATCTCGCAATGACG
CTGGCTTTTACTGCTCCCGCTGTGGGTATCGCCGCTCCAGAGGCCATATTGGCTTTCTACTGTCCAACCGATTAT
GAAGATCCATTTTGGTCGAGGCCAAACTTCCCCTTTGGACAGACTGTCGCGTCAAATGATATAGAGTACGATGTC
TGGGAAGGCGTGCAGAGCGCCCCGATCAAAGGCTATAATCCAGCGTTCAAGGAACGGCCACTAGGGGGCTGGATG
TCAACCAGCGACCCGCGTAGTCGGATTGCATTGCACATGAATTGGACGGGACAAACCCTCCCTGTGCTGTTGGGA
GGCATGCACAAAGAGTTTCGCATACCTGATGAACTACCTCGTCCGACAGACGAAGAGATTCAGGCAGTTAGTCCA
AACTATCAGATCCGCATCGGGCGGTACCGAACACCTACGTTTATGGTTCATGGAACAAGCGATGACCTTGTCCCG
TGCGCGCAGACCGAGTCAACATATAACGCGTTGACCCAAAACGGCATTGAGGCAGATATCAGGGTGGTGCAGGGA
GCGGTGCATCTATTTGATCTTTATCCGAGCTCTCATGCTGGCCAGAATGCGAAGGAAGCAGTGGCTGATGGGTAT
GAATTTTTGAAAAGACACATTCACTCTAAGGGTTATAGCGACAAGGATTAG
Transcript >Pro_DTO377G3_2|g3680.t1
ATGTCATTGAATACAGAGCATTCAAAAGGAGACCTTCGTCTTCTCTTCGGACCACAATGCTCTGAAATTGAAGAC
TCCATCGCCCACATCCGGGATGCCGTATACAAAGATTCAGCCGGTCTGGGGTTCTTATCTGATATTCTTGACGAG
CTTCCCTCCTTATGGCCCGTCATAACTTCTGCCTGGCCAGCCCTACGGAAGGTGCAGGGGGAGAAGCAACTAGCT
GCACTGGGGCGGCGTTTTGAGAATGGATCTCCAGATAGTGAAGCAGAACCCTCAAGTCTCATCATGACTCCAGTC
ACGGTGATGAAACATCTAGTTGACTTTTGGAATCTCCAAAACGTTGCGACACATCCGGCGTTTCCATCCTCGCCA
TTATCACGGACCACAGCCCCAAGGATAATCGACTCACAGGGGTTCTGTGTGGGTATTCTGGCGGCAATTGCTGTG
GCCTGCTCCCAGGATACACGGGAATTCCAGTCTTTGGCTTCGAACGCCATACGGCTCGCTGTCTGTATTGGGGCG
TTGGTGGACTTCGATGAGATCGTGTCGGGTAAGGCTAAGTCAATTGCAGTGCGGTGGGAGACCCCAGCGGACCAT
GACTATCTTGAACAGACCTTGACAAAAAGTCCCAATGTTTATATCTCCTGCTATACAGACGTTAACAGCGTCACT
ATCACTATCCCCGGTGACACTGCACAACGGGTCAAATTCAAACAGGAGCTTAGCGGCCGTGGTCTTCACACAAAG
CCGATCCCCCTCCAAGGCCGCTTCCACCACCAGCAAACACACCGCGAAGGCATCCAGCACATAATGAATCTATGT
GTGAAGGATCCTCGCTTTCAACTCCCTCACAGCAACGCGTTGATATTACCCCTTCGATCAAGTCACAATGGGCAG
GTGCTCATAAATGCAGCCATGTTGCACACTGTTGCCTTGGAATCAATCCTCTCTGTCAAGGCAGACTGGTGGGGA
ACAGTCTCCGCATTACTAAACAGCGCCGATATGGAAGTTGACGAGTCCCGTCTTCTATCCATCGGCCAGGAAGAG
TTCGTCCCACGATCAGCTAGAGGCCGTCTGGTAGCCAGGAGCAACCTTGATGTCTACGGGGCAGGAGTGTTTGCT
AACGGTAACACGTCGGCTCGCTCCGCAGTGTCGCTGCAGAACGGCACGAACACCCTCAATGGTAGTCCACAGGCA
GCTGAGATGCCACCTATTGCCATTACTGGCATGGCTTGTAGATATTCTAACGCAGACACCACGAGCGAGCTATGG
GATTTGCTGGAGCTGGGGGTATGTACAGTGGAGAAGGCCCCTGGGAATCGGTTCCGGATGCCAGACTTGCAGCGG
GAGCCCAAGGGCCCATTTTGGGGTCACTTCCTCGACCGGCCAGATGCATTCGACCATCGTTTTTTTAACATCTCA
GCGCGAGAGGCCGAGTCCATGGATCCACAACAACGCGTGTTGCTGCAAGTAGCATATGAAGCCATGGAGTCTGCC
GGATACTGCGGATGGCAGCACACTGAGCTATCGGACGAAATTGGCTGCTATGTGGGAGTGGGATCTGAGGACTAT
ACTGAGAATGTGGCATCGCGGAATGCGAATGCCTTCTCAGCCACAGGAACCCTGCAGTCATTTATAGCTGGCCGT
ATCAGCCATCATTTCGGCTGGTCGGGCCCATCGATTACGCTAGATACAGCGTGTTCATCCGCAGCAGTGGCTATC
CATATGGCATGCAAGGCCCTGCAAACAAAGGAGTGCTCGATTGCCGTGGCTGGCGGTGTGAATATTCTGACAAAC
CCCAGGGTGTACCAGAACCTGGCTGCTGCTTCTTTCCTGTCATCTACGGGAGCATGTAAGTCGTTTGATGTCTCT
GCGGATGGATACTGCCGCGGAGAGGGCGCTGGACTCGTTGTCCTTCGGCCATTGCAGGATGCGATTGACAACGGC
GACCCTATCCTCGGCGTGATCGCTGGCTCAGTCGTCAACCAGGGCTCGAACAGGTCACCCATCACCGTCCCCGAT
GCAGAGTCTCAACGATCGCTGTATAGAAAAGCTTTGTCACTCGCTGGGGTTGCCCCGGATGAGGTCACCTATGTG
GAGGCCCATGGCACTGGCACACAAGTTGGAGATCCGATTGAACTGGAAAGCCTTCGCAAGGCATTTGGAAACCCG
CTCCGAAGTCAGAGTCTCCATGTTGGGTCCATCAAGGGTAACATCGGACACACTGAGACCTCCTCGGGGGTCGCC
GGGCTGTTGAAGACGATCCTCATGCTTCAGAAGCAACGAATACCGAAACAGGCAAACTTCAGGCAGTTGAATCCC
AAGGTCATGCCTCCACTCGAGAACGACCGATTGGTGATTCCCGTAGAGTCAACCAAATGGGCATCAGCGAGACGG
GTTGCTATGGTCAGCAATTACGGGGCATCGGGGAGCAACGCCGCGCTTATAGTGAGAGACCACACTCCTAGCCTA
TCGGGACAGGGGAAGGCAATGGCGGAATACATTCGAGATATGCCTATCTTGATTTCTGCACGGTCTGAAGAATCT
ATTCGGGCCTATTGCGGTGCCCTTCGCACCACCCTTTTGAGGCATCCGTATTCCAATACCGTCGTCCGGGAATTG
GCGTACAACGTCGCAATGAAGCAGAATCGAACACTGCCGTTTACTCTTACCTTTTCAACCTCTTCTGATCCGACA
TCACTGAGCACCCGCTTGGAGGCTATCGCCGCAGGCAAGTCTGCCGATATTATCCAGAAGCGGGAATCCAACGAG
CCCCCAATAGTTTTGTGTTTCGGCGGTCAGAATGGAGTTACTTCGAGCATTTCACAAGAACTTTACGACAGCTGT
GTCCTTTTACAGACGCACCTCATGGCGTGCGAGCAAGCAGGCCAGAAGCTCGGCCTTCCCAGTCTTTTCCCAACT
ATCTTCACATCAGACCCCATCGTGAATACCGTTTACCTGCACTTCATGCTCTTCTCTATACAGTACGCATCTGCC
AGAGCCTGGATCGACTCAGGACTGCGCGTAGACCGCATAGTGGGCCATAGCTTTGGTCAGCTCACTGCGCTATCC
GTGGCTGGCAGTTTGAGTGTTCAAGAAGGCATCCGCCTGGTTACTGAGCGTGCACGCCTGATCCAGTCCAACTGG
GGCCCGGAGTCAGGGGTGATGCTCGCTGTGGAGGGTACGCAGGCCGAGGTCCAGCGTGTGCTAGAGCAGACAGGC
CACCGTGCTGAAATTGCCTGCTATAATGGACCACAGCAGCAAGTGCTTGCCGGCACGGGGGAATGCATCCGAGCG
GTTGAAGACGCTCTCGCTACAAACCCATTGACAAGCAACGTCAGGGTCAGACGTTTGGAGAACTCGCATGCCTTC
CACTCTAGACTTGTTGATAGCATTGTGCCCGGCCTCACAGAGCTCGCAGAGTCCTTTGTCTACCAAGCACCAGCT
ATCCCCATCGAAGCCTGTTCGGCGACTGGCGACTGGTCGATTGTCACCCCGGCAAAGATCGTCGAGCACAGTCGC
ATGCCCGTGCACTTCCAACGCGCTGTCGAAAGAATAGCTCAAAAACTACAAGTTCCCGCTGTCTGGCTCGAAGCC
GGCTCAGCCTCGCCTATCATCCCCATGGTGCGTCGAGTGCTGGAGAAATCGTCCGCAACTCACACATACCATAGG
GTTAACCTCGATGGGTCGGACGGAAGCGGGAATTTGGCAACTGTCACCAGCGCCCTCTGGGGTCAGGGCGTCCAT
GTCCAGTTCTGGCCCTTCCATCACTCGCAGCGTGGGACCTTCGGCTGGATGAACCTTCCGCCGTATCAGTTCGCG
AAGAACAGACACTGGGTTGACTTTGACCCTACTGCTTTCTCGTTTTCCGGATCCTCCGCCGAACCGCAATGTGGC
AGTCAGGAGCGGGCTGGCCTGTTGCGCAAGTTGAGCGACGGCCCAGAGGAGTATCTATTTGCCGTTAACACCCAA
GATGTATTGTATAGGTCATGCACGAAGGGGCACGCGGTATTGGACCAAACATTGTGTCCCGCATCCATGTATATG
GAGATGGTCCTGCGGGCAGCAACTTCCGTATTCACCTTGGGTGAATCCTCAACGCTGACTATGTCTCATATCGAG
GACCTGGTGATATCATCCCCCTTAGTATTAGATCCGCAAGGAAGCGTGTTCGTACGACTGATCCCAGAGGCAGTG
GCTTCTTCCCAGACGTGGTCATTCTCGATATTTAGCAGTAGCGGGACGGGTAATGAGTCGTCGATTCATGCTACA
GGCAGTGTATCCTTATGCAATGAAAGGTCCAGGGCTCTGTCACACTTTCAGTCTATGAATCGGTTGATGGACCCG
GCACGGGCAAGAGGAATTGAGGATCATCTGGCATCAAACGGACTGAAAGGATCGACGGTTTACTCTGCCCTCGAA
CAGGTTACCAATTATGCAGACTACTTCCGCGGAGTGAGGCAGGTGTTTGCAAATGGCCGTGAGGCTGCGGGGCTG
GTCAGTATGGCACCGTCAGCCACCGAGACCACGTGCAACCCCATCCTCCTGGACAACTTTCTGCAAGTTGCGGGA
ATTCACGTCAACTGCCTCTCTGGCCGCGAAGCAGAGGAAGTATTCGTGTGCAATGCTATCGGGGAAACGTATGTT
AGCGATTCGTTGTTCAAAAAGGAAGACGGAGCTATTCCGTTATCATGGAAGGTATATACCAACTACGTCCGGCCG
TCCAAGAATGAGATCGTGTGCGATATCTACGTGATGAACTCTCAAGGAGACGGTCTTACCGCCGCAATTATGGGC
GTTCGGTTCATGAGTGTCTCCATCCGCTCTCTCACTCGCGCACTGGCCAAGCTGAACAACAATTTCCCTGACGTC
CCACAACTCCCGCCCACGATCCAGCCAGCAATTGTGACAGCCGATTATGATGAAGCCAGTGACAATGTAAATGTG
GATAGCGACCTTGTTGCAGTCCAAGAGATGCTTTGCGAGCTGTTTGGAGTTAGTGTCGAAGAGGTATCTCCATCA
GTCTCGCTGATAGATATCGGAGTGGACTCGCTCATAAGCACAGAAGTGCTCTCCGAGATCAAGAGGAGATTCCAT
AAGGATATTTCCTATTCCACCTTGGTGGATATTCCCAACATCCAGGGTTTGACAGAGCATATCTTCCCGGGACAT
TCTCACCTAGCTCCTTCCCAGATTGTGATCAAACCAGTACGGCAGCAGACAGTGATACCGCAAACTGTAACTTCT
CTGCCTGTGCCAGCTAACGCCGGACCGTCGCTAGTCTCAGTAGCACACCAATGCTTCTATGAGACTCACGCCGCG
GTATCCCACACACACAATGCCGACTGGGCCGGCTTCTTCAATGCCATCTATCCGCAACAAATGACACTCATCACG
GCGTACATCCTGGAAGCATTCCGCGCCTTGGGCTCCCCGCTAGAGTCCAGTCAGGCAGATGAGGTCCTTCCTATT
ATTTCCGTCCTACCTCGCCACGAGCAGTTGAAGAAGCACCTGTATACAATTTTGGAATCCGTCAACCTCGTGCGC
CAAACTCCAACTGGTCAACTCGTGCGCACAGCGACACCCATCTCGCCGCTCTCATCACACGCCTTGCATGCCCAG
ATCCGGGATGAACACCCTCCATATGCACTGGAGCACGATCTTCTACAGATCACAGGCTCGCGGTTGGCTGAGTGT
CTGACCGGGCAAGCGGACGGGGTATCGCTAATTTTCCAGGATTCCCAGACTCGGCGCCTGGTAGGAGATGTCTAT
ACGGACTCCCCGGTGTTCAAGTCGGGTAACCTCTACCTCGCACAGTATCTCACGGATGTCATTCAAACTCTCGGA
AACGGTCGGCAGGTTAAAATCCTCGAGATCGGGGCCGGCACAGGAGGCACTACCAAGAATCTCCTCGAGCAGCTC
TCGGCCCTCCCCGGAATGGCGACACGCATGGAGTATACATTCACGGATATCTCGCCATCGCTTGTTGCAGCCGCG
CGGAAGAAGTTTTCCAAGTATGATTTCGTACGGTACGAAACTATTAACGTGGAGAGTAGCCCTCCCTCGCTCTTG
CACGGCCAATACGACATTGTGTTGTCGACCAACTGCGTCCATGCTACCCGAAATCTCGTCGAGTCCTGCTCAAAT
ATCCGCAAGCTCCTCCGGCCTGATGGGATCTTGTGTCTCGTTGAGCTGACGCGTGACATATTCTGGTTGGATCTT
GTGTTCGGACTCCTGGAGGGCTGGTGGCGGTTTGAGGACGGTCGGAAGCACGCGCTGGCCACTGAAGATCTTTGG
GATCAGACGCTTCGCCAATCTGGCTTCGAGTGGGTGGGCTGGACGAATAATGAGGCTGTAGAGTCAAATGCTCTG
CGCGTTATTGTCGCATCGCCGACGAAGGCCCCTTCTGCTCTGGAGATTTGCTCCAAGCCGGCAAACATGGAAACT
GTTGTTTGGGGCGAAAGAAATGGTCTGCAGCTGCTGGCTGATATATTTTATCCCGACGTGGTTGACACCACGCAG
AAACGACGAGCATGTGCTCTGATGGTTCATGGAGGTGGCCACGTCATGCTATCTCGTAAAGACATCCGTCCTGCC
CAGACACAGACCCTTCTCGATGCCGGATTCCTGCCCATCAGTGTTGACTACCGCCTGTGCCCTGAGGTTAGCCTT
TCAGAAGGCCCTATGGCCGACGTGCGCGACGCCCTAGGTTGGGTGCGCCGCATCCTCCCAAATATCCCCTTGCTA
CGTCCAGATATCCGACCGGACGGCAACCAGGTTGTGGCTATCGGGTGGTCCACTGGTGGTCATCTCGCAATGACG
CTGGCTTTTACTGCTCCCGCTGTGGGTATCGCCGCTCCAGAGGCCATATTGGCTTTCTACTGTCCAACCGATTAT
GAAGATCCATTTTGGTCGAGGCCAAACTTCCCCTTTGGACAGACTGTCGCGTCAAATGATATAGAGTACGATGTC
TGGGAAGGCGTGCAGAGCGCCCCGATCAAAGGCTATAATCCAGCGTTCAAGGAACGGCCACTAGGGGGCTGGATG
TCAACCAGCGACCCGCGTAGTCGGATTGCATTGCACATGAATTGGACGGGACAAACCCTCCCTGTGCTGTTGGGA
GGCATGCACAAAGAGTTTCGCATACCTGATGAACTACCTCGTCCGACAGACGAAGAGATTCAGGCAGTTAGTCCA
AACTATCAGATCCGCATCGGGCGGTACCGAACACCTACGTTTATGGTTCATGGAACAAGCGATGACCTTGTCCCG
TGCGCGCAGACCGAGTCAACATATAACGCGTTGACCCAAAACGGCATTGAGGCAGATATCAGGGTGGTGCAGGGA
GCGGTGCATCTATTTGATCTTTATCCGAGCTCTCATGCTGGCCAGAATGCGAAGGAAGCAGTGGCTGATGGGTAT
GAATTTTTGAAAAGACACATTCACTCTAAGGGTTATAGCGACAAGGATTAG
Gene >Pro_DTO377G3_2|g3680.t1
ATGTCATTGAATACAGAGCATTCAAAAGGAGACCTTCGTCTTCTCTTCGGACCACAATGCTCTGAAATTGAAGAC
TCCATCGCCCACATCCGGGATGCCGTATACAAAGATTCAGCCGGTCTGGGGTTCTTATCTGATATTCTTGACGAG
CTTCCCTCCTTATGGCCCGTCATAACTTCTGCCTGGCCAGCCCTACGGAAGGTGCAGGGGGAGAAGCAACTAGCT
GCACTGGGGCGGCGTTTTGAGAATGGATCTCCAGATAGTGAAGCAGAACCCTCAAGTCTCATCATGACTCCAGTC
ACGGTGATGAAACATCTAGTTGACTTTTGGAATCTCCAAAACGTTGCGACACATCCGGCGTTTCCATCCTCGCCA
TTATCACGGACCACAGCCCCAAGGATAATCGACTCACAGGGGTTCTGTGTGGGTATTCTGGCGGCAATTGCTGTG
GCCTGCTCCCAGGATACACGGGAATTCCAGTCTTTGGCTTCGAACGCCATACGGCTCGCTGTCTGTATTGGGGCG
TTGGTGGACTTCGATGAGATCGTGTCGGGTAAGGCTAAGTCAATTGCAGTGCGGTGGGAGACCCCAGCGGACCAT
GACTATCTTGAACAGACCTTGACAAAAAGTCCCAATGTTAGTTTCTCCTCATGGAAAGAAAAGGAAACAAAAGCA
AAGAGCTGATAGACATTCAAGGTTTATATCTCCTGCTATACAGACGTTAACAGCGTCACTATCACTATCCCCGGT
GACACTGCACAACGGGTCAAATTCAAACAGGAGCTTAGCGGCCGTGGTCTTCACACAAAGCCGATCCCCCTCCAA
GGCCGCTTCCACCACCAGCAAACACACCGCGAAGGCATCCAGCACATAATGAATCTATGTGTGAAGGATCCTCGC
TTTCAACTCCCTCACAGCAACGCGTTGATATTACCCCTTCGATCAAGTCACAATGGGCAGGTGCTCATAAATGCA
GCCATGTTGCACACTGTTGCCTTGGAATCAATCCTCTCTGTCAAGGCAGACTGGTGGGGAACAGTCTCCGCATTA
CTAAACAGCGCCGATATGGAAGTTGACGAGTCCCGTCTTCTATCCATCGGCCAGGAAGAGTTCGTCCCACGATCA
GCTAGAGGCCGTCTGGTAGCCAGGAGCAACCTTGATGTCTACGGGGCAGGAGTGTTTGCTAACGGTAACACGTCG
GCTCGCTCCGCAGTGTCGCTGCAGAACGGCACGAACACCCTCAATGGTAGTCCACAGGCAGCTGAGATGCCACCT
ATTGCCATTACTGGCATGGCTTGTAGATATTCTAACGCAGACACCACGAGCGAGCTATGGGATTTGCTGGAGCTG
GGGGTATGTACAGTGGAGAAGGCCCCTGGGAATCGGTTCCGGATGCCAGACTTGCAGCGGGAGCCCAAGGGCCCA
TTTTGGGGTCACTTCCTCGACCGGCCAGATGCATTCGACCATCGTTTTTTTAACATCTCAGCGCGAGAGGCCGAG
TCCATGGATCCACAACAACGCGTGTTGCTGCAAGTAGCATATGAAGCCATGGAGTCTGCCGGATACTGCGGATGG
CAGCACACTGAGCTATCGGACGAAATTGGCTGCTATGTGGGAGTGGGATCTGAGGACTATACTGAGAATGTGGCA
TCGCGGAATGCGAATGCCTTCTCAGCCACAGGAACCCTGCAGTCATTTATAGCTGGCCGTATCAGCCATCATTTC
GGCTGGTCGGGCCCATCGATTACGCTAGATACAGCGTGTTCATCCGCAGCAGTGGCTATCCATATGGCATGCAAG
GTACGATATGAGACTCCCATTGACCTATCTGAAAGTGCAATGGCTGACTGATGTATAAATGATAGGCCCTGCAAA
CAAAGGAGTGCTCGATTGCCGTGGCTGGCGGTGTGAATATTCTGACAAACCCCAGGGTGTACCAGAACCTGGCTG
CTGCTTCTTTCCTGTCATCTACGGGAGCATGTAAGTCGTTTGATGTCTCTGCGGATGGATACTGCCGCGGAGAGG
GCGCTGGACTCGTTGTCCTTCGGCCATTGCAGGATGCGATTGACAACGGCGACCCTATCCTCGGCGTGATCGCTG
GCTCAGTCGTCAACCAGGGCTCGAACAGGTCACCCATCACCGTCCCCGATGCAGAGTCTCAACGATCGCTGTATA
GAAAAGCTTTGTCACTCGCTGGGGTTGCCCCGGATGAGGTCACCTATGTGGAGGCCCATGGCACTGGTATGTATC
CTGCTTTCTTTTTACCCTTGGTCTCCTCTATTCTGCCCTCTTCTATTTCGCCTGCAGTTTAGTAACAATGTCAAA
GGCACACAAGTTGGAGATCCGATTGAACTGGAAAGCCTTCGCAAGGCATTTGGAAACCCGCTCCGAAGTCAGAGT
CTCCATGTTGGGTCCATCAAGGGTAACATCGGACACACTGAGACCTCCTCGGGGGTCGCCGGGCTGTTGAAGACG
ATCCTCATGCTTCAGAAGCAACGAATACCGAAACAGGCAAACTTCAGGCAGTTGAATCCCAAGGTCATGCCTCCA
CTCGAGAACGACCGATTGGTGATTCCCGTAGAGTCAACCAAATGGGCATCAGCGAGACGGGTTGCTATGGTCAGC
AATTACGGGGCATCGGGGAGCAACGCCGCGCTTATAGTGAGAGACCACACTCCTAGCCTATCGGGACAGGGGAAG
GCAATGGCGGAATACATTCGAGATATGCCTATCTTGATTTCTGCACGGTCTGAAGAATCTATTCGGGCCTATTGC
GGTGCCCTTCGCACCACCCTTTTGAGGCATCCGTATTCCAATACCGTCGTCCGGGAATTGGCGTACAACGTCGCA
ATGAAGCAGAATCGAACACTGCCGTTTACTCTTACCTTTTCAACCTCTTCTGATCCGACATCACTGAGCACCCGC
TTGGAGGCTATCGCCGCAGGCAAGTCTGCCGATATTATCCAGAAGCGGGAATCCAACGAGCCCCCAATAGTTTTG
TGTTTCGGCGGTCAGAATGGAGTTACTTCGAGCATTTCACAAGAACTTTACGACAGCTGTGTCCTTTTACAGACG
CACCTCATGGCGTGCGAGCAAGCAGGCCAGAAGCTCGGCCTTCCCAGTCTTTTCCCAACTATCTTCACATCAGAC
CCCATCGTGAATACCGTTTACCTGCACTTCATGCTCTTCTCTATACAGTACGCATCTGCCAGAGCCTGGATCGAC
TCAGGACTGCGCGTAGACCGCATAGTGGGCCATAGCTTTGGTCAGCTCACTGCGCTATCCGTGGCTGGCAGTTTG
AGTGTTCAAGAAGGCATCCGCCTGGTTACTGAGCGTGCACGCCTGATCCAGTCCAACTGGGGCCCGGAGTCAGGG
GTGATGCTCGCTGTGGAGGGTACGCAGGCCGAGGTCCAGCGTGTGCTAGAGCAGACAGGCCACCGTGCTGAAATT
GCCTGCTATAATGGACCACAGCAGCAAGTGCTTGCCGGCACGGGGGAATGCATCCGAGCGGTTGAAGACGCTCTC
GCTACAAACCCATTGACAAGCAACGTCAGGGTCAGACGTTTGGAGAACTCGCATGCCTTCCACTCTAGACTTGTT
GATAGCATTGTGCCCGGCCTCACAGAGCTCGCAGAGTCCTTTGTCTACCAAGCACCAGCTATCCCCATCGAAGCC
TGTTCGGCGACTGGCGACTGGTCGATTGTCACCCCGGCAAAGATCGTCGAGCACAGTCGCATGCCCGTGCACTTC
CAACGCGCTGTCGAAAGAATAGCTCAAAAACTACAAGTTCCCGCTGTCTGGCTCGAAGCCGGCTCAGCCTCGCCT
ATCATCCCCATGGTGCGTCGAGTGCTGGAGAAATCGTCCGCAACTCACACATACCATAGGGTTAACCTCGATGGG
TCGGACGGAAGCGGGAATTTGGCAACTGTCACCAGCGCCCTCTGGGGTCAGGGCGTCCATGTCCAGTTCTGGCCC
TTCCATCACTCGCAGCGTGGGACCTTCGGCTGGATGAACCTTCCGCCGTATCAGTTCGCGAAGAACAGACACTGG
GTTGACTTTGACCCTACTGCTTTCTCGTTTTCCGGATCCTCCGCCGAACCGCAATGTGGCAGTCAGGAGCGGGCT
GGCCTGTTGCGCAAGTTGAGCGACGGCCCAGAGGAGTATCTATTTGCCGTTAACACCCAAGATGTATTGTATAGG
TCATGCACGAAGGGGCACGCGGTATTGGACCAAACATTGTGTCCCGCATCCATGTATATGGAGATGGTCCTGCGG
GCAGCAACTTCCGTATTCACCTTGGGTGAATCCTCAACGCTGACTATGTCTCATATCGAGGACCTGGTGATATCA
TCCCCCTTAGTATTAGATCCGCAAGGAAGCGTGTTCGTACGACTGATCCCAGAGGCAGTGGCTTCTTCCCAGACG
TGGTCATTCTCGATATTTAGCAGTAGCGGGACGGGTAATGAGTCGTCGATTCATGCTACAGGCAGTGTATCCTTA
TGCAATGAAAGGTCCAGGGCTCTGTCACACTTTCAGTCTATGAATCGGTTGATGGACCCGGCACGGGCAAGAGGA
ATTGAGGATCATCTGGCATCAAACGGACTGAAAGGATCGACGGTTTACTCTGCCCTCGAACAGGTTACCAATTAT
GCAGACTACTTCCGCGGAGTGAGGCAGGTGTTTGCAAATGGCCGTGAGGCTGCGGGGCTGGTCAGTATGGCACCG
TCAGCCACCGAGACCACGTGCAACCCCATCCTCCTGGACAACTTTCTGCAAGTTGCGGGAATTCACGTCAACTGC
CTCTCTGGCCGCGAAGCAGAGGAAGTATTCGTGTGCAATGCTATCGGGGAAACGTATGTTAGCGATTCGTTGTTC
AAAAAGGAAGACGGAGCTATTCCGTTATCATGGAAGGTATATACCAACTACGTCCGGCCGTCCAAGAATGAGATC
GTGTGCGATATCTACGTGATGAACTCTCAAGGAGACGGTCTTACCGCCGCAATTATGGGCGTTCGGTTCATGAGT
GTCTCCATCCGCTCTCTCACTCGCGCACTGGCCAAGCTGAACAACAATTTCCCTGACGTCCCACAACTCCCGCCC
ACGATCCAGCCAGCAATTGTGACAGCCGATTATGATGAAGCCAGTGACAATGTAAATGTGGATAGCGACCTTGTT
GCAGTCCAAGAGATGCTTTGCGAGCTGTTTGGAGTTAGTGTCGAAGAGGTATCTCCATCAGTCTCGCTGATAGAT
ATCGGAGTGGACTCGCTCATAAGCACAGAAGTGCTCTCCGAGATCAAGAGGAGATTCCATAAGGATATTTCCTAT
TCCACCTTGGTGGATATTCCCAACATCCAGGGTTTGACAGAGCATATCTTCCCGGGACATTCTCACCTAGCTCCT
TCCCAGATTGTGATCAAACCAGTACGGCAGCAGACAGTGATACCGCAAACTGTAACTTCTCTGCCTGTGCCAGCT
AACGCCGGACCGTCGCTAGTCTCAGTAGCACACCAATGCTTCTATGAGACTCACGCCGCGGTATCCCACACACAC
AATGCCGACTGGGCCGGCTTCTTCAATGCCATCTATCCGCAACAAATGACACTCATCACGGCGTACATCCTGGAA
GCATTCCGCGCCTTGGGCTCCCCGCTAGAGTCCAGTCAGGCAGATGAGGTCCTTCCTATTATTTCCGTCCTACCT
CGCCACGAGCAGTTGAAGAAGCACCTGTATACAATTTTGGAATCCGTCAACCTCGTGCGCCAAACTCCAACTGGT
CAACTCGTGCGCACAGCGACACCCATCTCGCCGCTCTCATCACACGCCTTGCATGCCCAGATCCGGGATGAACAC
CCTCCATATGCACTGGAGCACGATCTTCTACAGATCACAGGCTCGCGGTTGGCTGAGTGTCTGACCGGGCAAGCG
GACGGGGTATCGCTAATTTTCCAGGATTCCCAGACTCGGCGCCTGGTAGGAGATGTCTATACGGACTCCCCGGTG
TTCAAGTCGGGTAACCTCTACCTCGCACAGTATCTCACGGATGTCATTCAAACTCTCGGAAACGGTCGGCAGGTT
AAAATCCTCGAGATCGGGGCCGGCACAGGAGGCACTACCAAGAATCTCCTCGAGCAGCTCTCGGCCCTCCCCGGA
ATGGCGACACGCATGGAGTATACATTCACGGATATCTCGCCATCGCTTGTTGCAGCCGCGCGGAAGAAGTTTTCC
AAGTATGATTTCGTACGGTACGAAACTATTAACGTGGAGAGTAGCCCTCCCTCGCTCTTGCACGGCCAATACGAC
ATTGTGTTGTCGACCAACTGCGTCCATGCTACCCGAAATCTCGTCGAGTCCTGCTCAAATATCCGCAAGCTCCTC
CGGCCTGATGGGATCTTGTGTCTCGTTGAGCTGACGCGTGACATATTCTGGTTGGATCTTGTGTTCGGACTCCTG
GAGGGCTGGTGGCGGTTTGAGGACGGTCGGAAGCACGCGCTGGCCACTGAAGATCTTTGGGATCAGACGCTTCGC
CAATCTGGCTTCGAGTGGGTGGGCTGGACGAATAATGAGGCTGTAGAGTCAAATGCTCTGCGCGTTATTGTCGCA
TCGCCGACGAAGGCCCCTTCTGCTCTGGAGATTTGCTCCAAGCCGGCAAACATGGAAACTGTTGTTTGGGGCGAA
AGAAATGGTCTGCAGCTGCTGGCTGATATATTTTATCCCGACGTGGTTGACACCACGCAGAAACGACGAGCATGT
GGTAAGTTCAAATTCATCTTTTGTCCCTTGTAATAACTCCATTTCATACTTTCATTTGCTAACCCTCTTCAGCTC
TGATGGTTCATGGAGGTGGCCACGTCATGCTATCTCGTAAAGACATCCGTCCTGCCCAGACACAGACCCTTCTCG
ATGCCGGATTCCTGCCCATCAGTGTTGACTACCGCCTGTGCCCTGAGGTTAGCCTTTCAGAAGGCCCTATGGCCG
ACGTGCGCGACGCCCTAGGTTGGGTGCGCCGCATCCTCCCAAATATCCCCTTGCTACGTCCAGATATCCGACCGG
ACGGCAACCAGGTTGTGGCTATCGGGTGGTCCACTGGTGGTCATCTCGCAATGACGCTGGCTTTTACTGCTCCCG
CTGTGGGTATCGCCGCTCCAGAGGCCATATTGGCTTTCTACTGTCCAACCGATTATGAAGATCCATTTTGGTCGA
GGCCAAACTTCCCCTTTGGACAGACTGTCGCGTCAAATGATATAGAGTACGATGTCTGGGAAGGCGTGCAGAGCG
CCCCGATCAAAGGCTATAATCCAGCGTTCAAGGAACGGCCACTAGGGGGCTGGATGTCAACCAGCGACCCGCGTA
GTCGGATTGCATTGCACATGAATTGGACGGGACAAACCCTCCCTGTGCTGTTGGGAGGCATGCACAAAGAGTTTC
GCATACCTGATGAACTACCTCGTCCGACAGACGAAGAGATTCAGGCAGTTAGTCCAAACTATCAGATCCGCATCG
GGCGGTACCGAACACCTACGTTTATGGTTCATGGAACAAGCGATGACCTTGTCCCGTGCGCGCAGACCGAGTCAA
CATATAACGCGTTGACCCAAAACGGCATTGAGGCAGATATCAGGGTGGTGCAGGGAGCGGTGCATCTATTTGATC
TTTATCCGAGCTCTCATGCTGGCCAGAATGCGAAGGAAGCAGTGGCTGATGGGTATGAATTTTTGAAAAGACACA
TTCACTCTAAGGGTTATAGCGACAAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail