Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3663.t1
Gene name
Locationscaffold_06:359639..361326
Strand+
Gene length (bp)1687
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-31 62 425
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-10 294 477
PF12832 MFS_1_like MFS_1 like family 2.8E-06 311 372

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 117 22
3 122 139 17
4 149 171 22
5 184 203 19
6 218 240 22
7 286 305 19
8 325 347 22
9 354 376 22
10 380 402 22
11 414 436 22
12 446 468 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3663.t1
MSSLPIEKAPQTMGAEEIPTKTEHPSGSEPARQKWHEWFAPTDTPAERRLILKLDGLIIVFVFLAYWAKVLDSSA
TSTAYVSGMKEDLKLYGNQLNYLQTVYMVGFITMQIPLTLLMTRCPVNYFLPAADLFWGVFTLAQYKASNVTQLY
ALRFFVGALGGFFFPAVQWYLGSWYKRSELSRRGAIFFIASQVGSMSSGYIQAGAYARLDGRYGIEGWRWLYIIC
FACTIPIAFLGLCLLPSTPDKCNSRFLSADEVRLAQERMASENREARQPFTKSRVLQILKGWRLWVLVGFAFFFS
QADGVSSNSGLPIWLKEEGYSVESINTITTVSPAVTIVASVICGVLSDVYDAKASLIAATALLNIFACIVLAIWN
VPIGLKFFAFFLSGTADGIAAIIYAWANEICAHSAEERAIVISAMNTIGNTFGAWIPLFVWKTVDAPRYLIGYNW
TIALDVCMLAMLAVLYQFWAREKKRSHA*
Coding >Pro_DTO377G3_2|g3663.t1
ATGTCTTCTCTACCCATTGAGAAAGCCCCGCAGACAATGGGAGCCGAGGAAATCCCCACGAAAACAGAGCATCCG
TCCGGTTCTGAGCCTGCACGCCAGAAATGGCATGAGTGGTTTGCGCCGACGGATACCCCTGCCGAGCGGCGGCTG
ATCCTCAAGCTCGATGGATTGATCATCGTCTTCGTATTCCTGGCGTACTGGGCTAAGGTCTTGGATTCATCGGCC
ACGAGTACAGCCTATGTATCTGGCATGAAGGAGGATTTGAAGCTTTATGGGAACCAATTAAATTATCTACAGACG
GTTTACATGGTTGGGTTCATCACGATGCAGATTCCTTTGACTTTGTTGATGACTCGCTGTCCCGTGAACTATTTC
CTGCCTGCCGCCGATCTATTCTGGGGTGTCTTCACTCTGGCACAGTACAAGGCTAGCAATGTCACCCAGCTCTAC
GCTCTCCGCTTTTTCGTTGGTGCCCTCGGGGGCTTCTTCTTCCCTGCCGTGCAATGGTACCTGGGCAGTTGGTAT
AAGCGCTCAGAACTGTCCCGCCGAGGCGCAATCTTTTTCATTGCCTCCCAAGTCGGCAGCATGAGTTCGGGATAC
ATTCAAGCGGGAGCTTATGCCAGGCTTGACGGTCGGTACGGGATTGAAGGGTGGAGATGGCTATACATAATTTGC
TTTGCATGCACTATTCCTATCGCCTTCCTAGGCCTATGCCTCCTCCCCAGCACACCAGACAAATGCAACTCGCGT
TTCCTCAGCGCCGACGAAGTCCGCCTCGCGCAAGAGCGCATGGCATCCGAGAACCGCGAAGCCCGTCAACCATTC
ACCAAGTCGAGGGTTCTCCAGATCCTGAAAGGCTGGCGGCTGTGGGTTCTAGTCGGATTTGCATTCTTCTTCTCG
CAGGCCGATGGTGTATCCTCGAACAGCGGCTTGCCAATCTGGCTCAAGGAGGAGGGATACTCGGTCGAGAGCATC
AACACGATCACGACAGTCTCGCCGGCGGTCACTATTGTGGCATCTGTGATCTGTGGAGTTCTCTCTGATGTGTAC
GATGCGAAAGCTAGCTTGATTGCTGCCACTGCTTTGCTGAATATCTTTGCTTGTATTGTGCTAGCGATCTGGAAT
GTCCCTATTGGACTGAAGTTCTTTGCGTTCTTCCTGTCAGGCACGGCGGATGGGATTGCAGCTATTATCTATGCC
TGGGCAAATGAGATCTGTGCCCATAGTGCCGAGGAGCGTGCTATTGTCATCAGTGCCATGAATACTATTGGTAAT
ACCTTTGGGGCTTGGATTCCGCTCTTTGTATGGAAGACTGTTGATGCTCCAAGGTACCTTATTGGATATAACTGG
ACTATTGCCCTTGATGTGTGCATGCTAGCTATGCTGGCTGTTCTATATCAGTTCTGGGCCCGCGAAAAGAAGCGA
TCCCATGCATAG
Transcript >Pro_DTO377G3_2|g3663.t1
ATGTCTTCTCTACCCATTGAGAAAGCCCCGCAGACAATGGGAGCCGAGGAAATCCCCACGAAAACAGAGCATCCG
TCCGGTTCTGAGCCTGCACGCCAGAAATGGCATGAGTGGTTTGCGCCGACGGATACCCCTGCCGAGCGGCGGCTG
ATCCTCAAGCTCGATGGATTGATCATCGTCTTCGTATTCCTGGCGTACTGGGCTAAGGTCTTGGATTCATCGGCC
ACGAGTACAGCCTATGTATCTGGCATGAAGGAGGATTTGAAGCTTTATGGGAACCAATTAAATTATCTACAGACG
GTTTACATGGTTGGGTTCATCACGATGCAGATTCCTTTGACTTTGTTGATGACTCGCTGTCCCGTGAACTATTTC
CTGCCTGCCGCCGATCTATTCTGGGGTGTCTTCACTCTGGCACAGTACAAGGCTAGCAATGTCACCCAGCTCTAC
GCTCTCCGCTTTTTCGTTGGTGCCCTCGGGGGCTTCTTCTTCCCTGCCGTGCAATGGTACCTGGGCAGTTGGTAT
AAGCGCTCAGAACTGTCCCGCCGAGGCGCAATCTTTTTCATTGCCTCCCAAGTCGGCAGCATGAGTTCGGGATAC
ATTCAAGCGGGAGCTTATGCCAGGCTTGACGGTCGGTACGGGATTGAAGGGTGGAGATGGCTATACATAATTTGC
TTTGCATGCACTATTCCTATCGCCTTCCTAGGCCTATGCCTCCTCCCCAGCACACCAGACAAATGCAACTCGCGT
TTCCTCAGCGCCGACGAAGTCCGCCTCGCGCAAGAGCGCATGGCATCCGAGAACCGCGAAGCCCGTCAACCATTC
ACCAAGTCGAGGGTTCTCCAGATCCTGAAAGGCTGGCGGCTGTGGGTTCTAGTCGGATTTGCATTCTTCTTCTCG
CAGGCCGATGGTGTATCCTCGAACAGCGGCTTGCCAATCTGGCTCAAGGAGGAGGGATACTCGGTCGAGAGCATC
AACACGATCACGACAGTCTCGCCGGCGGTCACTATTGTGGCATCTGTGATCTGTGGAGTTCTCTCTGATGTGTAC
GATGCGAAAGCTAGCTTGATTGCTGCCACTGCTTTGCTGAATATCTTTGCTTGTATTGTGCTAGCGATCTGGAAT
GTCCCTATTGGACTGAAGTTCTTTGCGTTCTTCCTGTCAGGCACGGCGGATGGGATTGCAGCTATTATCTATGCC
TGGGCAAATGAGATCTGTGCCCATAGTGCCGAGGAGCGTGCTATTGTCATCAGTGCCATGAATACTATTGGTAAT
ACCTTTGGGGCTTGGATTCCGCTCTTTGTATGGAAGACTGTTGATGCTCCAAGGTACCTTATTGGATATAACTGG
ACTATTGCCCTTGATGTGTGCATGCTAGCTATGCTGGCTGTTCTATATCAGTTCTGGGCCCGCGAAAAGAAGCGA
TCCCATGCATAG
Gene >Pro_DTO377G3_2|g3663.t1
ATGTCTTCTCTACCCATTGAGAAAGCCCCGCAGACAATGGGAGCCGAGGAAATCCCCACGAAAACAGAGCATCCG
TCCGGTTCTGAGCCTGCACGCCAGAAATGGCATGAGTGGTTTGCGCCGACGGATACCCCTGCCGAGCGGCGGCTG
ATCCTCAAGCTCGATGGATTGATCATCGTCTTCGTATTCCTGGCGTACTGGGCTAAGGTCTTGGATTCATCGGCC
ACGAGTACAGCCTATGTATCTGGCATGAAGGAGGATTTGAAGCTTTATGGGAACCAATTAAATTATCTACAGACG
GTTTACATGTATGTTTATACGATGGGTTGGTGGTGGCGGGGAGTGTGAATTGAGGTTTGATGCTGACTTGGTATA
GGGTTGGGTTCATCACGATGCAGATTCCTTTGACTTTGTTGGTTCGTTGTCACTTAGAATCTACCCCATGGAGAC
AATAATTTACTGACTGTCTTTTATAGATGACTCGCTGTCCCGTGAACTATTTCCTGCCTGCCGCCGATCTATTCT
GGGGTGTCTTCACTCTGGCACAGTACAAGGCTAGCAATGTCACCCAGCTCTACGCTCTCCGCTTTTTCGTTGGTG
CCCTCGGGGGCTTCTTCTTCCCTGCCGTGCAATGGTACCTGGGCAGTTGGTATAAGCGCTCAGAACTGTCCCGCC
GAGGCGCAATCTTTTTCATTGCCTCCCAAGTCGGCAGCATGAGTTCGGGATACATTCAAGCGGGAGCTTATGCCA
GGCTTGACGGTCGGTACGGGATTGAAGGGTGGAGATGGCTATACATAATTTGTGAGTGTATCCGAAGTGTCTCGC
AAAAGGAAGGAACAAAAGAGACACAGACTAATGATATCAGGCTTTGCATGCACTATTCCTATCGCCTTCCTAGGC
CTATGCCTCCTCCCCAGCACACCAGACAAATGCAACTCGCGTTTCCTCAGCGCCGACGAAGTCCGCCTCGCGCAA
GAGCGCATGGCATCCGAGAACCGCGAAGCCCGTCAACCATTCACCAAGTCGAGGGTTCTCCAGATCCTGAAAGGC
TGGCGGCTGTGGGTTCTAGTCGGATTTGCATTCTTCTTCTCGCAGGCCGATGGTGTATCCTCGAACAGCGGCTTG
CCAATCTGGCTCAAGGAGGAGGGATACTCGGTCGAGAGCATCAACACGATCACGACAGTCTCGCCGGCGGTCACT
ATTGTGGCATCTGTGATCTGTGGAGTTCTCTCTGATGTGTACGATGCGAAAGCTAGCTTGATTGCTGCCACTGCT
TTGCTGAATATCTTTGCTTGTATTGTGCTAGCGATCTGGAATGTCCCTATTGGACTGAAGTTCTTTGCGTTCTTC
CTGTCAGGCACGGCGGATGGGATTGCAGCTATTATCTATGCCTGGGCAAATGAGATCTGTGCCCATAGTGCCGAG
GAGCGTGCTATTGTCATCAGTGCCATGAATACTATTGGTAATACCTTTGGGGCTTGGATTCCGCTCTTGTGAGTG
TTGGTGCAACCTGCTGATCCTGAACTTTATACTAATCTTTTTCTTATCTAGTGTATGGAAGACTGTTGATGCTCC
AAGGTACCTTATTGGATATAACTGGACTATTGCCCTTGATGTGTGCATGCTAGCTATGCTGGCTGTTCTATATCA
GTTCTGGGCCCGCGAAAAGAAGCGATCCCATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail