Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3661.t1
Gene name
Locationscaffold_06:354449..357115
Strand+
Gene length (bp)2666
Transcript length (bp)2568
Coding sequence length (bp)2568
Protein length (aa) 856

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01496 V_ATPase_I V-type ATPase 116kDa subunit family 0.0E+00 31 845

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:1902600 proton transmembrane transport Yes
GO:0033179 proton-transporting V-type ATPase, V0 domain Yes
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:0055085 transmembrane transport No
GO:0015078 proton transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0098655 cation transmembrane transport No
GO:0022804 active transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015399 primary active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0009987 cellular process No
GO:0006812 cation transport No
GO:0098796 membrane protein complex No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0006811 ion transport No
GO:0034220 ion transmembrane transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 427 449 22
2 466 488 22
3 550 572 22
4 579 601 22
5 643 665 22
6 755 777 22
7 787 809 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3661.t1
MVPRDTFFRSADMSLTQLYIANEIGREVVSALGEVGQVQFRDLNPDTNAFQRTFTKEIRRLDNVERQLRYFHQQT
EKAAIPMRSSTDFSDTLAAPLASEIDELADRSESLEQRIISLNDSYETLKKREVELSEWRWVLREAGGFFDRAHT
QTEDIRQSLDNDEAPLLRDIEHHAPHQNGDTQGQQSFSEMNIGFVAGVIPRDRIGAFERILWRTLRGNLYMNQSE
IPEPIIDPMTNEEVHKNVFVIFAHGKNILAKIRKISESLNASLYGVDENSELRRDQIHEVNTRLGDVGNVLRNTK
NTLDAELSQIARSLAAWMIIVKKEKAVYDTLNKFSYDQARKTLIAEAWCPTNSLALIKSTLQDVNDRAGLTVPTI
VNQIRTNKTPPTFVRTNKFTEGFQTIVNAYGIPKYSEVNPGLYTVVTFPFLFAVMFGDCGHGALMTLAASAMIFW
EKKLARTKLDELTYMAFYGRYIMLMMGLFSIYTGFIYNDIFSKSFTFFPSQWEWPEDIKPGKMVEATLREGYRFP
IGLDWNWHEADNSLLFSNSMKMKMSVLLGWCHMTYALCLQYVNGRYFRSKVDIWGNFVPGLLFFQSIFGYLVLTI
LYKWTVNWQEKGVNPPGLLNMLIFMFLSPGTVDEQLYPGQSMVQVLLLLVAVAQVPVMLFLKPLWLRYEHNRARA
LGYRGLGENSRVSALDADGDLDGGLGRDSVASDGEGVAMLSQDIDESEEHEEFDFGDIMIHQVIHTIEFCLNCIS
HTASYLRLWALSLAHQQLSIVLWTMTIGGAFDQENPVTRVIMIVVSFYLWFVLTICILCVMEGTSAMLHSLRLHW
VEAMSKHFVGEGIPFLPFSFKTLLEEDPVD*
Coding >Pro_DTO377G3_2|g3661.t1
ATGGTTCCACGGGACACCTTCTTCCGCTCGGCGGATATGAGCTTGACCCAGCTCTATATTGCCAACGAGATCGGA
AGAGAAGTTGTCAGTGCATTGGGTGAAGTTGGCCAGGTTCAGTTCCGAGATCTCAACCCGGACACGAACGCTTTC
CAAAGAACCTTTACAAAAGAAATCCGCCGCCTGGACAATGTCGAAAGACAGCTCCGCTATTTCCACCAACAGACG
GAAAAGGCCGCAATCCCTATGAGATCTTCCACGGATTTCTCCGATACATTGGCCGCCCCCTTAGCGTCGGAGATC
GATGAGTTGGCTGATCGCAGTGAGAGCCTTGAACAGCGGATTATCTCTCTGAACGATAGCTATGAGACTTTGAAG
AAACGTGAAGTCGAGCTGAGCGAATGGCGATGGGTACTTAGAGAGGCCGGTGGATTTTTCGATCGGGCCCATACA
CAAACAGAAGACATTCGTCAGTCCTTGGACAACGATGAAGCTCCTCTGCTCCGTGATATCGAGCATCACGCCCCT
CATCAAAATGGAGACACTCAGGGTCAGCAGAGCTTCTCGGAAATGAACATTGGATTCGTGGCTGGTGTTATTCCC
CGGGATCGCATCGGAGCCTTTGAGCGTATCCTCTGGCGTACCCTGCGCGGAAATCTCTACATGAACCAGTCCGAG
ATTCCGGAGCCCATTATCGACCCAATGACGAACGAGGAAGTCCACAAGAATGTTTTCGTCATCTTCGCTCATGGC
AAGAACATTCTTGCTAAGATCCGCAAGATCTCGGAGTCGCTCAACGCCTCCTTGTACGGTGTCGATGAGAACAGT
GAGTTGAGGAGGGACCAGATTCACGAAGTCAACACCCGTCTCGGCGATGTTGGCAATGTGCTCCGTAACACCAAG
AACACCCTTGATGCGGAACTTTCCCAAATTGCTCGCTCGCTCGCCGCCTGGATGATCATTGTCAAGAAGGAGAAG
GCCGTTTATGATACCTTGAACAAATTCTCATACGACCAAGCGCGGAAGACGCTCATTGCCGAGGCGTGGTGCCCG
ACAAACTCTCTTGCTCTGATCAAGTCGACCCTCCAGGACGTGAACGACCGCGCGGGCCTCACTGTTCCTACAATC
GTCAACCAGATCCGAACAAACAAGACCCCTCCGACTTTTGTCAGGACGAACAAGTTCACCGAAGGGTTCCAAACA
ATCGTGAATGCTTACGGTATCCCTAAGTATTCGGAAGTCAATCCTGGCCTGTACACGGTCGTCACCTTTCCCTTC
TTGTTCGCAGTCATGTTTGGTGATTGCGGTCACGGTGCACTGATGACTCTAGCCGCTTCTGCTATGATTTTCTGG
GAAAAGAAGCTGGCGCGGACTAAACTGGATGAACTGACATACATGGCATTCTATGGACGGTATATTATGTTGATG
ATGGGTCTGTTCTCGATCTACACCGGTTTTATTTACAACGATATTTTCTCCAAATCTTTCACCTTCTTCCCCAGT
CAGTGGGAATGGCCCGAGGACATCAAGCCCGGCAAAATGGTCGAGGCAACATTGAGAGAAGGCTATCGCTTTCCA
ATTGGACTGGACTGGAACTGGCACGAAGCAGACAACTCCTTGCTATTTTCGAATAGTATGAAGATGAAGATGAGC
GTTCTCCTTGGATGGTGCCACATGACCTATGCCCTTTGCTTGCAATACGTCAATGGACGTTACTTCAGATCTAAG
GTTGACATCTGGGGAAATTTTGTTCCTGGATTGCTCTTCTTCCAGTCAATCTTTGGTTATCTTGTCCTCACTATA
CTCTACAAGTGGACCGTGAACTGGCAGGAGAAGGGTGTGAACCCTCCCGGTCTCCTCAACATGCTCATTTTCATG
TTCCTCAGCCCTGGTACGGTGGATGAACAACTCTATCCTGGCCAGAGCATGGTCCAGGTTCTTCTGCTCCTCGTC
GCTGTGGCCCAGGTACCTGTGATGCTCTTCCTCAAGCCTCTCTGGCTCCGCTACGAACACAACCGCGCTCGTGCC
TTGGGTTACCGCGGCCTCGGCGAGAACTCCAGGGTGAGCGCACTGGACGCCGATGGTGACTTGGACGGCGGGCTG
GGTCGTGACAGTGTGGCTAGCGACGGAGAAGGCGTGGCCATGCTTTCTCAGGACATCGATGAAAGCGAAGAGCAT
GAGGAGTTCGACTTTGGCGACATCATGATCCACCAAGTCATCCACACCATCGAATTCTGCCTCAACTGTATCTCT
CACACTGCTTCTTACCTTCGTTTGTGGGCTCTGTCGCTTGCCCACCAGCAACTTTCGATCGTTCTCTGGACCATG
ACCATTGGTGGTGCCTTTGACCAGGAGAACCCCGTGACCCGTGTGATCATGATTGTTGTCAGCTTCTACCTCTGG
TTTGTGCTGACGATTTGCATTCTGTGTGTGATGGAAGGTACCAGTGCCATGTTGCACTCGCTCCGTCTTCACTGG
GTTGAGGCAATGAGTAAGCATTTCGTTGGTGAGGGTATTCCTTTCCTGCCTTTCAGCTTCAAGACCCTGTTGGAG
GAGGACCCCGTGGACTAG
Transcript >Pro_DTO377G3_2|g3661.t1
ATGGTTCCACGGGACACCTTCTTCCGCTCGGCGGATATGAGCTTGACCCAGCTCTATATTGCCAACGAGATCGGA
AGAGAAGTTGTCAGTGCATTGGGTGAAGTTGGCCAGGTTCAGTTCCGAGATCTCAACCCGGACACGAACGCTTTC
CAAAGAACCTTTACAAAAGAAATCCGCCGCCTGGACAATGTCGAAAGACAGCTCCGCTATTTCCACCAACAGACG
GAAAAGGCCGCAATCCCTATGAGATCTTCCACGGATTTCTCCGATACATTGGCCGCCCCCTTAGCGTCGGAGATC
GATGAGTTGGCTGATCGCAGTGAGAGCCTTGAACAGCGGATTATCTCTCTGAACGATAGCTATGAGACTTTGAAG
AAACGTGAAGTCGAGCTGAGCGAATGGCGATGGGTACTTAGAGAGGCCGGTGGATTTTTCGATCGGGCCCATACA
CAAACAGAAGACATTCGTCAGTCCTTGGACAACGATGAAGCTCCTCTGCTCCGTGATATCGAGCATCACGCCCCT
CATCAAAATGGAGACACTCAGGGTCAGCAGAGCTTCTCGGAAATGAACATTGGATTCGTGGCTGGTGTTATTCCC
CGGGATCGCATCGGAGCCTTTGAGCGTATCCTCTGGCGTACCCTGCGCGGAAATCTCTACATGAACCAGTCCGAG
ATTCCGGAGCCCATTATCGACCCAATGACGAACGAGGAAGTCCACAAGAATGTTTTCGTCATCTTCGCTCATGGC
AAGAACATTCTTGCTAAGATCCGCAAGATCTCGGAGTCGCTCAACGCCTCCTTGTACGGTGTCGATGAGAACAGT
GAGTTGAGGAGGGACCAGATTCACGAAGTCAACACCCGTCTCGGCGATGTTGGCAATGTGCTCCGTAACACCAAG
AACACCCTTGATGCGGAACTTTCCCAAATTGCTCGCTCGCTCGCCGCCTGGATGATCATTGTCAAGAAGGAGAAG
GCCGTTTATGATACCTTGAACAAATTCTCATACGACCAAGCGCGGAAGACGCTCATTGCCGAGGCGTGGTGCCCG
ACAAACTCTCTTGCTCTGATCAAGTCGACCCTCCAGGACGTGAACGACCGCGCGGGCCTCACTGTTCCTACAATC
GTCAACCAGATCCGAACAAACAAGACCCCTCCGACTTTTGTCAGGACGAACAAGTTCACCGAAGGGTTCCAAACA
ATCGTGAATGCTTACGGTATCCCTAAGTATTCGGAAGTCAATCCTGGCCTGTACACGGTCGTCACCTTTCCCTTC
TTGTTCGCAGTCATGTTTGGTGATTGCGGTCACGGTGCACTGATGACTCTAGCCGCTTCTGCTATGATTTTCTGG
GAAAAGAAGCTGGCGCGGACTAAACTGGATGAACTGACATACATGGCATTCTATGGACGGTATATTATGTTGATG
ATGGGTCTGTTCTCGATCTACACCGGTTTTATTTACAACGATATTTTCTCCAAATCTTTCACCTTCTTCCCCAGT
CAGTGGGAATGGCCCGAGGACATCAAGCCCGGCAAAATGGTCGAGGCAACATTGAGAGAAGGCTATCGCTTTCCA
ATTGGACTGGACTGGAACTGGCACGAAGCAGACAACTCCTTGCTATTTTCGAATAGTATGAAGATGAAGATGAGC
GTTCTCCTTGGATGGTGCCACATGACCTATGCCCTTTGCTTGCAATACGTCAATGGACGTTACTTCAGATCTAAG
GTTGACATCTGGGGAAATTTTGTTCCTGGATTGCTCTTCTTCCAGTCAATCTTTGGTTATCTTGTCCTCACTATA
CTCTACAAGTGGACCGTGAACTGGCAGGAGAAGGGTGTGAACCCTCCCGGTCTCCTCAACATGCTCATTTTCATG
TTCCTCAGCCCTGGTACGGTGGATGAACAACTCTATCCTGGCCAGAGCATGGTCCAGGTTCTTCTGCTCCTCGTC
GCTGTGGCCCAGGTACCTGTGATGCTCTTCCTCAAGCCTCTCTGGCTCCGCTACGAACACAACCGCGCTCGTGCC
TTGGGTTACCGCGGCCTCGGCGAGAACTCCAGGGTGAGCGCACTGGACGCCGATGGTGACTTGGACGGCGGGCTG
GGTCGTGACAGTGTGGCTAGCGACGGAGAAGGCGTGGCCATGCTTTCTCAGGACATCGATGAAAGCGAAGAGCAT
GAGGAGTTCGACTTTGGCGACATCATGATCCACCAAGTCATCCACACCATCGAATTCTGCCTCAACTGTATCTCT
CACACTGCTTCTTACCTTCGTTTGTGGGCTCTGTCGCTTGCCCACCAGCAACTTTCGATCGTTCTCTGGACCATG
ACCATTGGTGGTGCCTTTGACCAGGAGAACCCCGTGACCCGTGTGATCATGATTGTTGTCAGCTTCTACCTCTGG
TTTGTGCTGACGATTTGCATTCTGTGTGTGATGGAAGGTACCAGTGCCATGTTGCACTCGCTCCGTCTTCACTGG
GTTGAGGCAATGAGTAAGCATTTCGTTGGTGAGGGTATTCCTTTCCTGCCTTTCAGCTTCAAGACCCTGTTGGAG
GAGGACCCCGTGGACTAG
Gene >Pro_DTO377G3_2|g3661.t1
ATGGTTCCACGGGACACCTTCTTCCGCTCGGCGGATATGAGCTTGACCCAGCTCTATATTGCCAACGAGATCGGA
AGAGAAGTTGTCAGTGCATTGGGTGAAGTTGGCCAGGTTCAGTTCCGAGATGTAAGTGACGAAGAGCGCTTTGCT
TTGATACTCCCGCTAACGTCTTCCTAGCTCAACCCGGACACGAACGCTTTCCAAAGAACCTTTACAAAAGAAATC
CGCCGCCTGGACAATGTCGAAAGACAGCTCCGCTATTTCCACCAACAGACGGAAAAGGCCGCAATCCCTATGAGA
TCTTCCACGGATTTCTCCGATACATTGGCCGCCCCCTTAGCGTCGGAGATCGATGAGTTGGCTGATCGCAGTGAG
AGCCTTGAACAGCGGATTATCTCTCTGAACGATAGCTATGAGACTTTGAAGAAACGTGAAGTCGAGCTGAGCGAA
TGGCGATGGGTACTTAGAGAGGCCGGTGGATTTTTCGATCGGGTAAGTTGCCTCGAGTATACCGTTGATAGACAA
GGCTAACTGAATAGGCCCATACACAAACAGAAGACATTCGTCAGTCCTTGGACAACGATGAAGCTCCTCTGCTCC
GTGATATCGAGCATCACGCCCCTCATCAAAATGGAGACACTCAGGGTCAGCAGAGCTTCTCGGAAATGAACATTG
GATTCGTGGCTGGTGTTATTCCCCGGGATCGCATCGGAGCCTTTGAGCGTATCCTCTGGCGTACCCTGCGCGGAA
ATCTCTACATGAACCAGTCCGAGATTCCGGAGCCCATTATCGACCCAATGACGAACGAGGAAGTCCACAAGAATG
TTTTCGTCATCTTCGCTCATGGCAAGAACATTCTTGCTAAGATCCGCAAGATCTCGGAGTCGCTCAACGCCTCCT
TGTACGGTGTCGATGAGAACAGTGAGTTGAGGAGGGACCAGATTCACGAAGTCAACACCCGTCTCGGCGATGTTG
GCAATGTGCTCCGTAACACCAAGAACACCCTTGATGCGGAACTTTCCCAAATTGCTCGCTCGCTCGCCGCCTGGA
TGATCATTGTCAAGAAGGAGAAGGCCGTTTATGATACCTTGAACAAATTCTCATACGACCAAGCGCGGAAGACGC
TCATTGCCGAGGCGTGGTGCCCGACAAACTCTCTTGCTCTGATCAAGTCGACCCTCCAGGACGTGAACGACCGCG
CGGGCCTCACTGTTCCTACAATCGTCAACCAGATCCGAACAAACAAGACCCCTCCGACTTTTGTCAGGACGAACA
AGTTCACCGAAGGGTTCCAAACAATCGTGAATGCTTACGGTATCCCTAAGTATTCGGAAGTCAATCCTGGCCTGT
ACACGGTCGTCACCTTTCCCTTCTTGTTCGCAGTCATGTTTGGTGATTGCGGTCACGGTGCACTGATGACTCTAG
CCGCTTCTGCTATGATTTTCTGGGAAAAGAAGCTGGCGCGGACTAAACTGGATGAACTGACATACATGGCATTCT
ATGGACGGTATATTATGTTGATGATGGGTCTGTTCTCGATCTACACCGGTTTTATTTACAACGATATTTTCTCCA
AATCTTTCACCTTCTTCCCCAGTCAGTGGGAATGGCCCGAGGACATCAAGCCCGGCAAAATGGTCGAGGCAACAT
TGAGAGAAGGCTATCGCTTTCCAATTGGACTGGACTGGAACTGGCACGAAGCAGACAACTCCTTGCTATTTTCGA
ATAGTATGAAGATGAAGATGAGCGTTCTCCTTGGATGGTGCCACATGACCTATGCCCTTTGCTTGCAATACGTCA
ATGGACGTTACTTCAGATCTAAGGTTGACATCTGGGGAAATTTTGTTCCTGGATTGCTCTTCTTCCAGTCAATCT
TTGGTTATCTTGTCCTCACTATACTCTACAAGTGGACCGTGAACTGGCAGGAGAAGGGTGTGAACCCTCCCGGTC
TCCTCAACATGCTCATTTTCATGTTCCTCAGCCCTGGTACGGTGGATGAACAACTCTATCCTGGCCAGAGCATGG
TCCAGGTTCTTCTGCTCCTCGTCGCTGTGGCCCAGGTACCTGTGATGCTCTTCCTCAAGCCTCTCTGGCTCCGCT
ACGAACACAACCGCGCTCGTGCCTTGGGTTACCGCGGCCTCGGCGAGAACTCCAGGGTGAGCGCACTGGACGCCG
ATGGTGACTTGGACGGCGGGCTGGGTCGTGACAGTGTGGCTAGCGACGGAGAAGGCGTGGCCATGCTTTCTCAGG
ACATCGATGAAAGCGAAGAGCATGAGGAGTTCGACTTTGGCGACATCATGATCCACCAAGTCATCCACACCATCG
AATTCTGCCTCAACTGTATCTCTCACACTGCTTCTTACCTTCGTTTGTGGGCTCTGTCGCTTGCCCACCAGCAAC
TTTCGATCGTTCTCTGGACCATGACCATTGGTGGTGCCTTTGACCAGGAGAACCCCGTGACCCGTGTGATCATGA
TTGTTGTCAGCTTCTACCTCTGGTTTGTGCTGACGATTTGCATTCTGTGTGTGATGGAAGGTACCAGTGCCATGT
TGCACTCGCTCCGTCTTCACTGGGTTGAGGCAATGAGTAAGCATTTCGTTGGTGAGGGTATTCCTTTCCTGCCTT
TCAGCTTCAAGACCCTGTTGGAGGAGGACCCCGTGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail