Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3655.t1
Gene name
Locationscaffold_06:336130..338558
Strand-
Gene length (bp)2428
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 2.3E-29 439 538
PF18151 DUF5601 Domain of unknown function (DUF5601) 7.9E-15 297 361
PF02845 CUE CUE domain 3.1E-08 712 753

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3655.t1
MSATESPSSPGPDTRDVPHIHEHTETPAAPTDRLAQTQDGLVRPDSSQIVQMSAQDTTEAHPAATPSDPAAMDLT
TAQPPQAEAEQLAGQLEGLSVSGDATPNLSSSANTPPPPPPQKDDVYLNLTSSTTTAPTLPSIDPNHTPGPEKEL
PDVPSDSDPEFKRAGQAEGPRDDNASQPEIQSIMGQFQDPAQSTDQNVIMSPRLELAEQLRSGPTYFPPRQSSLD
HAASTESVTAPVATPEKQPVSQRPQMPESPVPNRRASTSTILPLPEPEPDQPFDFHRFLEQLRHRTADPVAKFLR
SFLMEFGKKQWMVHEQVKIISDFLTFITNKMAMCEIWRDVSDSEFDNAKEGMEKLVMNRLYSQTFAPAIPSPPTI
PRSASRTRRRELERLHGPWRRGQHQEDVERDDILAQKIRIYSWVNETHLDIPTVSGGGRRFLNLAQQEISKINGY
RAPRDKVICILNCCKVIFGLLKNSKKADTSADSFIPLLIYVVLHANPDHLVSNIQYILRFRNQDKLGGEAGYYIS
SLSGAIQFIETLDRTSLTVSDEEFESNVEAAVSAIAEQNRESETFEEKPPTQPPPSQPQAGPSRKETTQSSDEDT
APVAGLLRTIQNPLSTIGRIFSDDGDSGSAPQERPQPVPTPQPGVAPPRLTPNVYQPPRASSEDRRSGDERARGS
GTSAKKNLSRVLDAQDAAARQASAEDAEARRIQRAEHNNVVETLSNMFPNLDHDLIDDVVKMKEGRVGLAVDACL
ALSAE*
Coding >Pro_DTO377G3_2|g3655.t1
ATGTCGGCCACAGAATCCCCGTCCTCTCCGGGTCCCGATACGAGAGACGTCCCCCATATCCATGAACACACCGAA
ACGCCGGCCGCTCCAACCGACCGCCTAGCTCAAACACAGGACGGTCTCGTCAGACCAGACAGCAGTCAAATAGTC
CAAATGAGCGCGCAGGATACAACAGAGGCACACCCCGCGGCTACTCCCTCCGATCCCGCCGCGATGGACTTGACG
ACTGCCCAACCACCACAGGCTGAGGCTGAGCAACTTGCGGGGCAGCTGGAAGGACTGTCGGTCTCCGGAGATGCG
ACTCCAAATCTGTCATCCAGCGCAAATACTCCTCCGCCCCCTCCGCCCCAGAAAGATGATGTCTACCTCAACCTG
ACAAGTTCTACGACCACTGCGCCAACGCTGCCATCTATCGATCCAAACCACACCCCCGGCCCCGAAAAAGAGCTC
CCAGATGTGCCTAGTGACAGTGACCCGGAATTTAAACGAGCTGGTCAGGCTGAAGGACCTCGGGACGATAATGCC
TCCCAGCCAGAGATTCAAAGTATCATGGGACAATTCCAGGACCCCGCGCAGAGCACCGACCAAAATGTGATCATG
TCACCACGGCTTGAGCTTGCTGAGCAACTGCGAAGCGGTCCAACATATTTCCCGCCACGCCAATCCAGTTTGGAC
CATGCGGCTTCCACCGAGTCCGTGACCGCTCCGGTCGCTACCCCGGAGAAGCAGCCTGTATCCCAACGTCCGCAG
ATGCCCGAATCGCCGGTACCAAACCGGAGAGCGTCCACCTCGACGATCCTACCGCTGCCGGAACCAGAGCCTGAC
CAACCATTCGATTTTCACCGCTTCCTAGAACAGCTGCGACACCGCACCGCCGACCCCGTAGCCAAGTTTCTGCGG
TCATTCCTCATGGAGTTTGGCAAGAAGCAATGGATGGTTCACGAGCAAGTCAAGATCATCAGCGATTTCTTGACG
TTTATCACAAATAAGATGGCCATGTGCGAGATCTGGCGAGATGTTTCGGATAGCGAGTTCGACAATGCCAAGGAA
GGCATGGAGAAACTTGTTATGAATCGTCTGTATTCGCAGACTTTCGCCCCAGCCATTCCATCTCCACCGACGATA
CCCAGAAGCGCAAGTCGGACCCGACGGAGAGAGCTAGAGAGGCTCCATGGGCCGTGGCGACGTGGCCAGCATCAG
GAGGACGTTGAGCGAGACGATATCCTGGCTCAGAAGATACGCATTTACAGCTGGGTCAACGAAACACATCTGGAC
ATCCCGACTGTGAGCGGTGGTGGACGCCGTTTCTTGAATCTGGCACAGCAAGAAATATCAAAAATCAATGGCTAC
CGGGCTCCTCGAGACAAGGTCATTTGCATCTTAAACTGCTGCAAAGTCATATTTGGTTTATTAAAGAATTCCAAA
AAGGCCGACACATCTGCCGACTCTTTCATCCCCCTCCTGATCTATGTGGTTTTGCATGCAAACCCTGATCATCTT
GTTTCTAACATCCAATATATTCTTCGATTCCGCAACCAGGATAAACTGGGCGGAGAAGCAGGTTATTACATTTCA
TCGTTGTCTGGAGCCATCCAGTTCATCGAAACTCTCGACCGCACAAGTTTAACAGTCAGCGACGAGGAATTCGAA
AGCAACGTCGAAGCCGCCGTGTCCGCTATCGCAGAACAAAACCGGGAATCAGAAACCTTCGAAGAAAAACCTCCC
ACTCAACCCCCTCCATCTCAGCCCCAGGCTGGACCAAGCCGCAAAGAAACTACTCAATCCAGTGACGAAGACACC
GCCCCAGTCGCAGGACTACTACGCACTATCCAAAACCCCCTCTCCACCATCGGCCGCATCTTCTCCGACGACGGA
GATTCAGGCTCCGCTCCTCAAGAACGTCCTCAGCCTGTCCCGACACCCCAACCAGGTGTTGCTCCTCCCCGTCTC
ACTCCGAATGTCTACCAGCCACCCCGCGCAAGCAGCGAGGACCGCCGCTCAGGCGATGAGCGCGCCCGCGGTAGC
GGAACCTCTGCGAAGAAGAATCTAAGCCGTGTGCTCGACGCTCAGGATGCTGCCGCACGCCAGGCTAGTGCTGAA
GATGCGGAGGCGCGTCGCATCCAACGCGCTGAACATAATAATGTTGTCGAGACACTCTCGAACATGTTTCCCAAC
CTGGATCATGATCTTATTGACGACGTCGTTAAGATGAAAGAGGGAAGGGTTGGTCTAGCTGTTGATGCTTGTCTT
GCTCTCAGCGCAGAGTAG
Transcript >Pro_DTO377G3_2|g3655.t1
ATGTCGGCCACAGAATCCCCGTCCTCTCCGGGTCCCGATACGAGAGACGTCCCCCATATCCATGAACACACCGAA
ACGCCGGCCGCTCCAACCGACCGCCTAGCTCAAACACAGGACGGTCTCGTCAGACCAGACAGCAGTCAAATAGTC
CAAATGAGCGCGCAGGATACAACAGAGGCACACCCCGCGGCTACTCCCTCCGATCCCGCCGCGATGGACTTGACG
ACTGCCCAACCACCACAGGCTGAGGCTGAGCAACTTGCGGGGCAGCTGGAAGGACTGTCGGTCTCCGGAGATGCG
ACTCCAAATCTGTCATCCAGCGCAAATACTCCTCCGCCCCCTCCGCCCCAGAAAGATGATGTCTACCTCAACCTG
ACAAGTTCTACGACCACTGCGCCAACGCTGCCATCTATCGATCCAAACCACACCCCCGGCCCCGAAAAAGAGCTC
CCAGATGTGCCTAGTGACAGTGACCCGGAATTTAAACGAGCTGGTCAGGCTGAAGGACCTCGGGACGATAATGCC
TCCCAGCCAGAGATTCAAAGTATCATGGGACAATTCCAGGACCCCGCGCAGAGCACCGACCAAAATGTGATCATG
TCACCACGGCTTGAGCTTGCTGAGCAACTGCGAAGCGGTCCAACATATTTCCCGCCACGCCAATCCAGTTTGGAC
CATGCGGCTTCCACCGAGTCCGTGACCGCTCCGGTCGCTACCCCGGAGAAGCAGCCTGTATCCCAACGTCCGCAG
ATGCCCGAATCGCCGGTACCAAACCGGAGAGCGTCCACCTCGACGATCCTACCGCTGCCGGAACCAGAGCCTGAC
CAACCATTCGATTTTCACCGCTTCCTAGAACAGCTGCGACACCGCACCGCCGACCCCGTAGCCAAGTTTCTGCGG
TCATTCCTCATGGAGTTTGGCAAGAAGCAATGGATGGTTCACGAGCAAGTCAAGATCATCAGCGATTTCTTGACG
TTTATCACAAATAAGATGGCCATGTGCGAGATCTGGCGAGATGTTTCGGATAGCGAGTTCGACAATGCCAAGGAA
GGCATGGAGAAACTTGTTATGAATCGTCTGTATTCGCAGACTTTCGCCCCAGCCATTCCATCTCCACCGACGATA
CCCAGAAGCGCAAGTCGGACCCGACGGAGAGAGCTAGAGAGGCTCCATGGGCCGTGGCGACGTGGCCAGCATCAG
GAGGACGTTGAGCGAGACGATATCCTGGCTCAGAAGATACGCATTTACAGCTGGGTCAACGAAACACATCTGGAC
ATCCCGACTGTGAGCGGTGGTGGACGCCGTTTCTTGAATCTGGCACAGCAAGAAATATCAAAAATCAATGGCTAC
CGGGCTCCTCGAGACAAGGTCATTTGCATCTTAAACTGCTGCAAAGTCATATTTGGTTTATTAAAGAATTCCAAA
AAGGCCGACACATCTGCCGACTCTTTCATCCCCCTCCTGATCTATGTGGTTTTGCATGCAAACCCTGATCATCTT
GTTTCTAACATCCAATATATTCTTCGATTCCGCAACCAGGATAAACTGGGCGGAGAAGCAGGTTATTACATTTCA
TCGTTGTCTGGAGCCATCCAGTTCATCGAAACTCTCGACCGCACAAGTTTAACAGTCAGCGACGAGGAATTCGAA
AGCAACGTCGAAGCCGCCGTGTCCGCTATCGCAGAACAAAACCGGGAATCAGAAACCTTCGAAGAAAAACCTCCC
ACTCAACCCCCTCCATCTCAGCCCCAGGCTGGACCAAGCCGCAAAGAAACTACTCAATCCAGTGACGAAGACACC
GCCCCAGTCGCAGGACTACTACGCACTATCCAAAACCCCCTCTCCACCATCGGCCGCATCTTCTCCGACGACGGA
GATTCAGGCTCCGCTCCTCAAGAACGTCCTCAGCCTGTCCCGACACCCCAACCAGGTGTTGCTCCTCCCCGTCTC
ACTCCGAATGTCTACCAGCCACCCCGCGCAAGCAGCGAGGACCGCCGCTCAGGCGATGAGCGCGCCCGCGGTAGC
GGAACCTCTGCGAAGAAGAATCTAAGCCGTGTGCTCGACGCTCAGGATGCTGCCGCACGCCAGGCTAGTGCTGAA
GATGCGGAGGCGCGTCGCATCCAACGCGCTGAACATAATAATGTTGTCGAGACACTCTCGAACATGTTTCCCAAC
CTGGATCATGATCTTATTGACGACGTCGTTAAGATGAAAGAGGGAAGGGTTGGTCTAGCTGTTGATGCTTGTCTT
GCTCTCAGCGCAGAGTAG
Gene >Pro_DTO377G3_2|g3655.t1
ATGTCGGCCACAGAATCCCCGTCCTCTCCGGGTCCCGATACGAGAGACGTCCCCCATATCCATGAACACACCGAA
ACGCCGGCCGCTCCAACCGACCGCCTAGCTCAAACACAGGACGGTCTCGTCAGACCAGACAGCAGTCAAATAGTC
CAAATGAGCGCGCAGGATACAACAGAGGCACACCCCGCGGCTACTCCCTCCGATCCCGCCGCGATGGACTTGACG
ACTGCCCAACCACCACAGGCTGAGGCTGAGCAACTTGCGGGGCAGCTGGAAGGACTGTCGGTCTCCGGAGATGCG
ACTCCAAATCTGTCATCCAGCGCAAATACTCCTCCGCCCCCTCCGCCCCAGAAAGATGATGTCTACCTCAACCTG
ACAAGTTCTACGACCACTGCGCCAACGCTGCCATCTATCGATCCAAACCACACCCCCGGCCCCGAAAAAGAGCTC
CCAGATGTGCCTAGTGACAGTGACCCGGAATTTAAACGAGCTGGTCAGGCTGAAGGACCTCGGGACGATAATGCC
TCCCAGCCAGAGATTCAAAGTATCATGGGACAATTCCAGGACCCCGCGCAGAGCACCGACCAAAATGTGATCATG
TCACCACGGCTTGAGCTTGCTGAGCAACTGCGAAGCGGTCCAACATATTTCCCGCCACGCCAATCCAGTTTGGAC
CATGCGGCTTCCACCGAGTCCGTGACCGCTCCGGTCGCTACCCCGGAGAAGCAGCCTGTATCCCAACGTCCGCAG
ATGCCCGAATCGCCGGTACCAAACCGGAGAGCGTCCACCTCGACGATCCTACCGCTGCCGGAACCAGAGCCTGAC
CAACCATTCGATTTTCACCGCTTCCTAGAACAGCTGCGACACCGCACCGCCGACCCCGTAGCCAAGTTTCTGCGG
TCATTCCTCATGGAGTTTGGCAAGAAGCAATGGATGGTTCACGAGCAAGTCAAGATCATCAGCGATTTCTTGACG
TTTATCACAAATAAGATGGCCATGTGCGAGATCTGGCGAGATGTTTCGGATAGCGAGTTCGACAATGCCAAGGAA
GGCATGGAGAAACTTGTTATGAATCGTCTGTATTCGCAGACTTTCGCCCCAGCCATTCCATCTCCACCGACGATA
CCCAGAAGCGCAAGTCGGACCCGACGGAGAGAGCTAGAGAGGCTCCATGGGCCGTGGCGACGTGGCCAGCATCAG
GAGGACGTTGAGCGAGACGATATCCTGGCTCAGAAGATACGCATTTACAGCTGGGTCAACGAAACACATCTGGAC
ATCCCGACTGTGAGCGGTGGTGGACGCCGTTTCTTGAATCTGGCACAGCAAGGTATGTACTATGTTCTGGAGATT
TTCCAACTTGACTTTTCTGACTTTGCTTGACAGAAATATCAAAAATCAATGGCTACCGGGCTCCTCGAGACAAGG
TCATTTGCATCTTAAACTGCTGCAAAGTCATATTTGGTTTATTAAAGAATTCCAAAAAGGCCGACACATCTGCCG
ACTCTTTCATCCCCCTCCTGATCTATGTGGTTTTGCATGCAAACCCTGATCATCTTGTTTCTAACATCCAATATA
TTCTTCGATTCCGCAACCAGGATAAACTGGGCGGAGAAGCAGGTTATTACATTTCATCGTTGGTATGTTTGACTT
CCATACTGCCATAGATATCCAAACTAACCTGTCCTAGTCTGGAGCCATCCAGTTCATCGAAACTCTCGACCGCAC
AAGTTTAACAGTCAGCGACGAGGAATTCGAAAGCAACGTCGAAGCCGCCGTGTCCGCTATCGCAGAACAAAACCG
GGAATCAGAAACCTTCGAAGAAAAACCTCCCACTCAACCCCCTCCATCTCAGCCCCAGGCTGGACCAAGCCGCAA
AGAAACTACTCAATCCAGTGACGAAGACACCGCCCCAGTCGCAGGACTACTACGCACTATCCAAAACCCCCTCTC
CACCATCGGCCGCATCTTCTCCGACGACGGAGATTCAGGCTCCGCTCCTCAAGAACGTCCTCAGCCTGTCCCGAC
ACCCCAACCAGGTGTTGCTCCTCCCCGTCTCACTCCGAATGTCTACCAGCCACCCCGCGCAAGCAGCGAGGACCG
CCGCTCAGGCGATGAGCGCGCCCGCGGTAGCGGAACCTCTGCGAAGAAGAATCTAAGCCGTGTGCTCGACGCTCA
GGATGCTGCCGCACGCCAGGCTAGTGCTGAAGATGCGGAGGCGCGTCGCATCCAACGCGCTGAACATAATAATGT
TGTCGAGACACTCTCGAACATGTTTCCCAACCTGGATCATGATCTTATTGACGACGTCGTTAAGATGAAAGAGGG
AAGGTGAGTACTTGAAAAGGTTTATACTATTGGATCTTTACTAACTGTTCCTCGCAGGGTTGGTCTAGCTGTTGA
TGCTTGTCTTGCTCTCAGCGCAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail