Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3644.t1
Gene name
Locationscaffold_06:297198..298456
Strand+
Gene length (bp)1258
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.1E-07 167 376

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 69.75 41.62 97.89
5d_25C Five days - 25 degrees Celsius 62.37 36.83 87.91
7d_25C Seven days - 25 degrees Celsius 62.08 36.75 87.42
10d_25C Ten days - 25 degrees Celsius 49.05 27.90 70.19
7d_15C Seven days - 15 degrees Celsius 47.28 27.00 67.55
7d_30C Seven days - 30 degrees Celsius 62.83 37.20 88.46

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.708897 no
3d_25C 7d_25C 0.690480 no
3d_25C 7d_15C 0.089205 no
3d_25C 7d_30C 0.728248 no
3d_25C 10d_25C 0.131376 no
5d_25C 7d_25C 0.989967 no
5d_25C 7d_15C 0.265251 no
5d_25C 7d_30C 0.984770 no
5d_25C 10d_25C 0.355258 no
7d_25C 7d_15C 0.274368 no
7d_25C 7d_30C 0.974413 no
7d_25C 10d_25C 0.365397 no
7d_15C 7d_30C 0.258848 no
7d_15C 10d_25C 0.921111 no
7d_30C 10d_25C 0.340892 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3644.t1
MLSFRTLASLTYLTHVAFASLGGNVQAHGSQLRDIVPRREVLYVGGRYTNITENATNSTSMVMIGQIYVEKLSPQ
SAPVNPPLPIIFIAGAAQTGTNFLDTPDGRPGWASYFISKGHTVYLSDQPARGRSFWSPGQGSIGYIGSPDSVSD
IFTDVANNDNQWPQAKLHTQWPGTGRIGDSTFDAFYRSQMQFQTDRFISEEQNAQAYSALVDLVGDCYIISHSQA
GAYGWRVGDMRPDLVKGIVQLEPSGPPFTLRPPFGNDPAFAFGLTDLAIGYEPSAGENAENIETTIEPAIDADHD
QCIMQKSPAKQLTNLGKIPELVVTGEASFHAPYDYCTVKYLEQAGVDVEYADLGKEGIHGNGHMFFMEKNNLEIA
DRVYKWLEKH*
Coding >Pro_DTO377G3_2|g3644.t1
ATGTTGAGCTTTCGCACCTTGGCTTCCCTCACATATTTGACGCATGTCGCTTTCGCTTCTCTAGGAGGCAATGTG
CAAGCTCATGGCTCCCAGCTTAGGGACATTGTTCCTAGGCGCGAGGTTCTCTACGTTGGCGGACGATACACGAAC
ATCACAGAAAATGCAACCAATTCTACATCAATGGTTATGATAGGGCAAATTTACGTCGAGAAGCTCTCCCCTCAG
TCAGCCCCGGTGAACCCACCACTTCCCATTATTTTCATTGCAGGCGCGGCTCAGACCGGCACCAATTTTCTTGAT
ACTCCAGACGGACGGCCAGGATGGGCATCCTATTTCATCTCCAAGGGTCACACAGTCTACCTCTCAGATCAGCCC
GCACGCGGTCGCTCCTTCTGGTCACCCGGACAGGGAAGTATTGGGTACATCGGCTCCCCCGATTCGGTCTCTGAT
ATTTTCACCGACGTAGCAAACAACGACAACCAATGGCCACAGGCGAAGCTTCACACGCAATGGCCTGGCACCGGT
CGCATTGGCGACTCAACTTTCGACGCTTTCTACAGGAGCCAGATGCAATTCCAGACCGACCGCTTCATAAGCGAG
GAACAAAATGCGCAGGCGTATTCAGCTCTAGTCGACCTCGTCGGTGACTGTTATATCATCAGTCATTCGCAGGCG
GGTGCATATGGCTGGAGGGTCGGAGACATGCGCCCAGACCTAGTCAAAGGTATTGTCCAACTCGAGCCGTCTGGT
CCGCCGTTCACGCTCCGCCCGCCGTTTGGAAATGACCCAGCTTTCGCTTTCGGTCTCACCGACCTCGCAATCGGA
TACGAACCGTCTGCAGGCGAGAATGCCGAAAATATTGAGACAACCATCGAGCCAGCAATTGACGCTGATCACGAC
CAATGCATCATGCAGAAATCCCCAGCGAAACAGTTGACAAACCTGGGCAAAATCCCAGAACTTGTTGTTACAGGC
GAAGCATCGTTCCACGCGCCATACGATTACTGCACCGTCAAGTATCTGGAGCAAGCTGGAGTAGACGTTGAGTAC
GCAGATCTAGGCAAAGAGGGTATTCATGGCAACGGACACATGTTCTTCATGGAGAAGAACAACCTTGAGATCGCA
GACCGGGTGTACAAGTGGCTGGAAAAGCACTAA
Transcript >Pro_DTO377G3_2|g3644.t1
ATGTTGAGCTTTCGCACCTTGGCTTCCCTCACATATTTGACGCATGTCGCTTTCGCTTCTCTAGGAGGCAATGTG
CAAGCTCATGGCTCCCAGCTTAGGGACATTGTTCCTAGGCGCGAGGTTCTCTACGTTGGCGGACGATACACGAAC
ATCACAGAAAATGCAACCAATTCTACATCAATGGTTATGATAGGGCAAATTTACGTCGAGAAGCTCTCCCCTCAG
TCAGCCCCGGTGAACCCACCACTTCCCATTATTTTCATTGCAGGCGCGGCTCAGACCGGCACCAATTTTCTTGAT
ACTCCAGACGGACGGCCAGGATGGGCATCCTATTTCATCTCCAAGGGTCACACAGTCTACCTCTCAGATCAGCCC
GCACGCGGTCGCTCCTTCTGGTCACCCGGACAGGGAAGTATTGGGTACATCGGCTCCCCCGATTCGGTCTCTGAT
ATTTTCACCGACGTAGCAAACAACGACAACCAATGGCCACAGGCGAAGCTTCACACGCAATGGCCTGGCACCGGT
CGCATTGGCGACTCAACTTTCGACGCTTTCTACAGGAGCCAGATGCAATTCCAGACCGACCGCTTCATAAGCGAG
GAACAAAATGCGCAGGCGTATTCAGCTCTAGTCGACCTCGTCGGTGACTGTTATATCATCAGTCATTCGCAGGCG
GGTGCATATGGCTGGAGGGTCGGAGACATGCGCCCAGACCTAGTCAAAGGTATTGTCCAACTCGAGCCGTCTGGT
CCGCCGTTCACGCTCCGCCCGCCGTTTGGAAATGACCCAGCTTTCGCTTTCGGTCTCACCGACCTCGCAATCGGA
TACGAACCGTCTGCAGGCGAGAATGCCGAAAATATTGAGACAACCATCGAGCCAGCAATTGACGCTGATCACGAC
CAATGCATCATGCAGAAATCCCCAGCGAAACAGTTGACAAACCTGGGCAAAATCCCAGAACTTGTTGTTACAGGC
GAAGCATCGTTCCACGCGCCATACGATTACTGCACCGTCAAGTATCTGGAGCAAGCTGGAGTAGACGTTGAGTAC
GCAGATCTAGGCAAAGAGGGTATTCATGGCAACGGACACATGTTCTTCATGGAGAAGAACAACCTTGAGATCGCA
GACCGGGTGTACAAGTGGCTGGAAAAGCACTAA
Gene >Pro_DTO377G3_2|g3644.t1
ATGTTGAGCTTTCGCACCTTGGCTTCCCTCACATATTTGACGCATGTCGCTTTCGCTTCTCTAGGAGGCAATGTG
CAAGCTCATGGCTCCCAGCTTAGGGACATTGTTCCTAGGCGCGAGGTTCTCTACGTTGGCGGACGATACACGAAC
ATCACAGCAAGTCTTGATTCCCACCAATTCGACGCGTATCTAAGTCGTCAAACAGGAAAATGCAACCAATTCTAC
ATCAATGGTTATGATAGGGCAAATTTACGTCGAGAAGCTCTCCCCTCAGTCAGCCCCGGTGAACCCACCACTTCC
CATTATTTTCATTGCAGGCGCGGCTCAGACCGGCACCAATTTTCTTGATACTCCAGACGGACGGCCAGGATGGGC
ATCCTATTTCATCTCCAAGGGTCACACAGTCTACCTCTCAGATCAGCCCGCACGCGGTCGCTCCTTCTGGTCACC
CGGACAGGGAAGTATTGGGTACATCGGCTCCCCCGATTCGGTCTCTGATATTTTCACCGACGTAGCAAACAACGA
CAACCAATGGCCACAGGCGAAGCTTCACACGCAATGGCCTGGCACCGGTCGCATTGGCGACTCAACTTTCGACGC
TTTCTACAGGAGCCAGATGCAATTCCAGACCGACCGCTTCATAAGCGAGGAACAAAATGCGCAGGCGTATTCAGC
TCTAGTCGACCTCGTCGGTGACTGTTATATCATCAGTCATTCGCAGGCGGGTGCATATGGTAATTTCAGCCAAGC
ACTATGACTCACTGAGGTGGTTAACAATTGAATAGGCTGGAGGGTCGGAGACATGCGCCCAGACCTAGTCAAAGG
TATTGTCCAACTCGAGCCGTCTGGTCCGCCGTTCACGCTCCGCCCGCCGTTTGGAAATGACCCAGCTTTCGCTTT
CGGTCTCACCGACCTCGCAATCGGATACGAACCGTCTGCAGGCGAGAATGCCGAAAATATTGAGACAACCATCGA
GCCAGCAATTGACGCTGATCACGACCAATGCATCATGCAGAAATCCCCAGCGAAACAGTTGACAAACCTGGGCAA
AATCCCAGAACTTGTTGTTACAGGCGAAGCATCGTTCCACGCGCCATACGATTACTGCACCGTCAAGTATCTGGA
GCAAGCTGGAGTAGACGTTGAGTACGCAGATCTAGGCAAAGAGGGTATTCATGGCAACGGACACATGTTCTTCAT
GGAGAAGAACAACCTTGAGATCGCAGACCGGGTGTACAAGTGGCTGGAAAAGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail