Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3634.t1
Gene name
Locationscaffold_06:273794..277202
Strand-
Gene length (bp)3408
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 4.0E-62 277 673
PF00027 cNMP_binding Cyclic nucleotide-binding domain 1.6E-14 963 1040
PF01740 STAS STAS domain 1.7E-10 735 843

GO

GO Term Description Terminal node
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0008272 sulfate transport Yes
GO:0016021 integral component of membrane Yes
GO:0015698 inorganic anion transport No
GO:0031224 intrinsic component of membrane No
GO:0008509 anion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0015075 ion transmembrane transporter activity No
GO:0006820 anion transport No
GO:0072348 sulfur compound transport No
GO:0044425 membrane part No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008150 biological_process No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006811 ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 270 292 22
2 368 390 22
3 402 424 22
4 444 466 22
5 473 492 19
6 540 562 22
7 582 604 22
8 624 646 22
9 667 689 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3634.t1
MAVLQPRGRRDSRASALSRNLMFDRDIQGNAPSETLVEHANPGSPPGPMGAESSSYNGSTTRTPNRSFYHRSFNS
NMDPAHYASGGLRDQTAELATYGLSLNKNSLLRDGSGLPPTLDIFHGRRDSASYSQDEAANPQSAAGEALLEPGY
PSVDPASASGPSALTEMIRRPLTDTEEDQATQPGTDDISFPPPMIYAEPERDNESTSLLSKSRSKSIQNYGSASD
AENQRAAAQRSPNLITKGISSVTHYTRILSNPKAWDGRAIWKDAVVYPASLVPAVLLGLLLNILDALSYGMILFP
LGEPLFAHLGTDGISMFYVSTIISQVVFSCGGSIFKGGIGSEMIEVVPFFHQMAFTIMNSVGKDNPKSVIATTIL
AFSVSSVLTGLVFFLMGVCGLGSLIGFFPRHILIGCIGGVGYFLLQTGMEVSARLPGSLEYNLPTIQKLFTLDTF
PLWMIPLFLAIGLLVLKRFVRSNFLVGGYFIAVAAVFYIVILSARISMGALRHNGWVFAAPSSNNPWYHFYSLYD
LSAVNWTAFGETIPAMFALTFFGVLHVPINVPALGISTGEDNLNVDRELMAHGVTNALSGFAGSIQNYLVYTNSL
LFIASGGSSRLAGLMLAAATAGIMVIGPVIIGFIPIMVVGALIFLLGIELLQEALVDTWGKLTRLEYLTVVIIVV
TMGAWDFVVGIFIGIILACVNFVVQTSRKSAIRATFSGEISGSTVRRPPIQQEFLREAGQQTLIIKLGGYLFFGT
IVNVENTMRGLIEEEAFDRRPIRFIILDFTRVYGIDFSAAEAFTRINRVLQKRNVQTAISGLDVESDVGRSLQNV
GLFEPESGVPIFEDLNSALEFCENNYLKVFYNRQQALSTPTDSTANSELLQIPASVPVPSGPKPITLTDNIVSSP
RRQHLQRVATSTIQAHETTMMASPAWSAMRQPLPLLLQTFQGLSTENEDFWFPACAYFSCECYPAGTVLYHEGDA
PRAFYLLESGMLRAGYDLPQGRYFELIVAGRPCGELPFFSDTRRTATVKAERDCVAWCLTGAQWKVLQEKEPRIA
RELLTVSLKLTTERMDSITSYVLTMAA*
Coding >Pro_DTO377G3_2|g3634.t1
ATGGCGGTTTTGCAGCCTCGTGGCCGTCGCGACTCTCGTGCATCAGCGCTATCACGCAATCTGATGTTTGACCGC
GACATCCAGGGTAACGCCCCATCAGAAACGTTGGTGGAACATGCAAATCCAGGTAGCCCGCCCGGTCCAATGGGA
GCAGAATCATCCAGCTACAATGGATCAACGACAAGAACACCAAACCGTTCATTTTACCACCGGTCCTTCAATAGC
AATATGGATCCGGCTCATTATGCTTCAGGCGGTCTCCGTGACCAGACTGCGGAACTCGCTACCTATGGCCTTTCG
CTGAATAAGAATTCCCTCTTGAGGGACGGCTCCGGCTTACCCCCCACCCTTGATATATTCCACGGCAGACGGGAT
TCTGCAAGTTACTCCCAGGACGAAGCTGCAAACCCTCAATCCGCAGCGGGGGAGGCGTTATTGGAGCCAGGGTAT
CCCTCAGTTGACCCTGCTTCGGCTTCAGGTCCTTCGGCCTTGACAGAGATGATTCGCCGTCCGTTGACGGATACG
GAGGAGGACCAGGCCACACAACCCGGGACCGATGATATCTCCTTCCCCCCACCGATGATCTATGCGGAACCCGAA
CGAGACAATGAAAGCACCTCGTTATTATCTAAATCACGATCCAAATCTATACAAAACTATGGAAGTGCAAGTGAC
GCTGAGAATCAAAGGGCGGCTGCACAACGATCTCCAAACTTAATAACGAAAGGAATTTCATCCGTCACCCATTAT
ACTCGGATCTTGTCGAACCCAAAGGCATGGGATGGGCGAGCCATATGGAAAGATGCTGTGGTATACCCCGCAAGT
CTGGTTCCTGCCGTATTACTGGGTCTACTGCTCAACATTCTTGATGCTTTATCCTATGGAATGATCTTGTTCCCT
CTGGGAGAACCCCTGTTCGCTCACCTGGGAACTGACGGTATCTCGATGTTCTATGTCAGTACCATTATATCCCAA
GTGGTATTCTCCTGTGGAGGCTCGATCTTCAAAGGAGGAATAGGAAGTGAGATGATTGAAGTAGTACCCTTCTTC
CACCAGATGGCTTTCACCATCATGAATTCAGTCGGCAAGGACAACCCGAAATCAGTGATTGCAACGACCATTCTA
GCCTTTTCGGTCAGTTCGGTTCTCACCGGCTTGGTGTTCTTCTTAATGGGTGTATGTGGGCTGGGCTCACTCATT
GGCTTCTTTCCCCGTCATATTCTCATCGGGTGCATCGGTGGTGTGGGCTACTTTCTTCTACAGACTGGAATGGAG
GTTTCAGCCCGGCTCCCCGGGTCTCTCGAGTACAACCTCCCCACGATTCAGAAACTTTTCACTCTCGATACTTTC
CCTCTTTGGATGATACCCCTCTTCCTTGCCATTGGACTTCTTGTTCTCAAACGATTTGTTCGCTCGAACTTCCTT
GTCGGCGGATACTTCATTGCCGTTGCTGCAGTGTTCTACATTGTCATCTTAAGCGCTAGGATTTCTATGGGCGCT
CTGCGCCACAATGGATGGGTCTTTGCTGCCCCGTCTTCGAACAACCCGTGGTATCATTTCTATTCTCTCTATGAT
CTCTCGGCGGTCAATTGGACTGCCTTTGGTGAGACAATTCCGGCCATGTTCGCTTTGACATTCTTTGGTGTGCTT
CATGTGCCCATCAACGTACCTGCTCTCGGCATATCCACCGGCGAAGACAATCTCAACGTTGACAGAGAGCTCATG
GCACATGGCGTGACGAATGCACTTTCAGGATTCGCAGGAAGCATTCAGAACTATCTTGTTTATACCAACAGTCTT
CTCTTCATTGCAAGTGGCGGGTCATCTCGGTTGGCTGGTCTGATGTTGGCCGCAGCCACTGCAGGGATTATGGTC
ATTGGCCCAGTAATAATCGGCTTTATTCCTATTATGGTCGTTGGTGCCTTGATCTTCTTGTTGGGCATTGAGCTT
TTGCAGGAGGCATTGGTGGACACATGGGGAAAACTCACCCGGCTTGAATATCTAACCGTTGTCATTATCGTTGTC
ACTATGGGCGCTTGGGACTTCGTGGTCGGAATCTTCATTGGGATCATTTTGGCCTGTGTGAACTTTGTGGTCCAA
ACGTCTCGGAAATCTGCCATTCGAGCAACATTCTCGGGTGAAATTTCCGGGTCAACGGTCCGACGTCCTCCTATC
CAACAGGAGTTCCTACGCGAAGCTGGGCAGCAGACCCTGATTATCAAGCTTGGTGGATATCTCTTTTTTGGGACC
ATCGTGAATGTCGAGAACACCATGCGTGGCCTGATCGAGGAGGAAGCTTTCGACCGTCGTCCCATTCGATTCATC
ATTCTCGATTTTACTCGAGTCTACGGAATCGACTTCTCGGCCGCAGAAGCATTCACCCGCATCAACCGCGTTCTT
CAAAAGCGCAACGTACAAACGGCCATATCCGGCTTGGATGTCGAAAGTGACGTAGGAAGGTCCCTACAAAATGTA
GGACTTTTCGAGCCAGAATCTGGCGTCCCTATCTTCGAAGACCTGAACTCAGCCCTTGAGTTCTGCGAGAACAAC
TACCTGAAAGTCTTCTACAACCGCCAGCAAGCACTTTCCACACCCACCGATTCAACTGCAAACTCCGAGCTCCTC
CAAATCCCCGCCTCAGTCCCCGTGCCCTCAGGACCCAAACCTATCACCCTAACCGACAACATTGTCAGCTCACCC
CGCCGCCAGCACCTACAGCGCGTGGCGACCTCAACCATCCAAGCCCACGAAACAACAATGATGGCCTCCCCCGCC
TGGTCCGCCATGCGCCAACCACTCCCACTCCTCCTCCAAACCTTCCAAGGCCTCTCAACCGAAAACGAAGACTTT
TGGTTCCCCGCCTGCGCCTACTTCTCCTGCGAATGCTACCCCGCCGGCACAGTCCTGTACCACGAAGGCGACGCC
CCGCGCGCCTTCTACCTCCTCGAGTCTGGCATGCTGCGCGCTGGCTACGACCTCCCACAGGGCCGCTACTTCGAG
CTCATTGTCGCTGGTCGACCGTGCGGCGAACTGCCTTTCTTCAGTGATACACGCCGCACGGCGACGGTCAAGGCC
GAGCGCGATTGTGTGGCTTGGTGTTTAACGGGGGCGCAGTGGAAGGTGCTACAGGAGAAAGAGCCGCGCATTGCT
CGTGAACTGTTGACGGTTAGCTTGAAGTTGACGACTGAGCGCATGGATAGTATCACCTCGTATGTTTTGACGATG
GCGGCTTGA
Transcript >Pro_DTO377G3_2|g3634.t1
ATGGCGGTTTTGCAGCCTCGTGGCCGTCGCGACTCTCGTGCATCAGCGCTATCACGCAATCTGATGTTTGACCGC
GACATCCAGGGTAACGCCCCATCAGAAACGTTGGTGGAACATGCAAATCCAGGTAGCCCGCCCGGTCCAATGGGA
GCAGAATCATCCAGCTACAATGGATCAACGACAAGAACACCAAACCGTTCATTTTACCACCGGTCCTTCAATAGC
AATATGGATCCGGCTCATTATGCTTCAGGCGGTCTCCGTGACCAGACTGCGGAACTCGCTACCTATGGCCTTTCG
CTGAATAAGAATTCCCTCTTGAGGGACGGCTCCGGCTTACCCCCCACCCTTGATATATTCCACGGCAGACGGGAT
TCTGCAAGTTACTCCCAGGACGAAGCTGCAAACCCTCAATCCGCAGCGGGGGAGGCGTTATTGGAGCCAGGGTAT
CCCTCAGTTGACCCTGCTTCGGCTTCAGGTCCTTCGGCCTTGACAGAGATGATTCGCCGTCCGTTGACGGATACG
GAGGAGGACCAGGCCACACAACCCGGGACCGATGATATCTCCTTCCCCCCACCGATGATCTATGCGGAACCCGAA
CGAGACAATGAAAGCACCTCGTTATTATCTAAATCACGATCCAAATCTATACAAAACTATGGAAGTGCAAGTGAC
GCTGAGAATCAAAGGGCGGCTGCACAACGATCTCCAAACTTAATAACGAAAGGAATTTCATCCGTCACCCATTAT
ACTCGGATCTTGTCGAACCCAAAGGCATGGGATGGGCGAGCCATATGGAAAGATGCTGTGGTATACCCCGCAAGT
CTGGTTCCTGCCGTATTACTGGGTCTACTGCTCAACATTCTTGATGCTTTATCCTATGGAATGATCTTGTTCCCT
CTGGGAGAACCCCTGTTCGCTCACCTGGGAACTGACGGTATCTCGATGTTCTATGTCAGTACCATTATATCCCAA
GTGGTATTCTCCTGTGGAGGCTCGATCTTCAAAGGAGGAATAGGAAGTGAGATGATTGAAGTAGTACCCTTCTTC
CACCAGATGGCTTTCACCATCATGAATTCAGTCGGCAAGGACAACCCGAAATCAGTGATTGCAACGACCATTCTA
GCCTTTTCGGTCAGTTCGGTTCTCACCGGCTTGGTGTTCTTCTTAATGGGTGTATGTGGGCTGGGCTCACTCATT
GGCTTCTTTCCCCGTCATATTCTCATCGGGTGCATCGGTGGTGTGGGCTACTTTCTTCTACAGACTGGAATGGAG
GTTTCAGCCCGGCTCCCCGGGTCTCTCGAGTACAACCTCCCCACGATTCAGAAACTTTTCACTCTCGATACTTTC
CCTCTTTGGATGATACCCCTCTTCCTTGCCATTGGACTTCTTGTTCTCAAACGATTTGTTCGCTCGAACTTCCTT
GTCGGCGGATACTTCATTGCCGTTGCTGCAGTGTTCTACATTGTCATCTTAAGCGCTAGGATTTCTATGGGCGCT
CTGCGCCACAATGGATGGGTCTTTGCTGCCCCGTCTTCGAACAACCCGTGGTATCATTTCTATTCTCTCTATGAT
CTCTCGGCGGTCAATTGGACTGCCTTTGGTGAGACAATTCCGGCCATGTTCGCTTTGACATTCTTTGGTGTGCTT
CATGTGCCCATCAACGTACCTGCTCTCGGCATATCCACCGGCGAAGACAATCTCAACGTTGACAGAGAGCTCATG
GCACATGGCGTGACGAATGCACTTTCAGGATTCGCAGGAAGCATTCAGAACTATCTTGTTTATACCAACAGTCTT
CTCTTCATTGCAAGTGGCGGGTCATCTCGGTTGGCTGGTCTGATGTTGGCCGCAGCCACTGCAGGGATTATGGTC
ATTGGCCCAGTAATAATCGGCTTTATTCCTATTATGGTCGTTGGTGCCTTGATCTTCTTGTTGGGCATTGAGCTT
TTGCAGGAGGCATTGGTGGACACATGGGGAAAACTCACCCGGCTTGAATATCTAACCGTTGTCATTATCGTTGTC
ACTATGGGCGCTTGGGACTTCGTGGTCGGAATCTTCATTGGGATCATTTTGGCCTGTGTGAACTTTGTGGTCCAA
ACGTCTCGGAAATCTGCCATTCGAGCAACATTCTCGGGTGAAATTTCCGGGTCAACGGTCCGACGTCCTCCTATC
CAACAGGAGTTCCTACGCGAAGCTGGGCAGCAGACCCTGATTATCAAGCTTGGTGGATATCTCTTTTTTGGGACC
ATCGTGAATGTCGAGAACACCATGCGTGGCCTGATCGAGGAGGAAGCTTTCGACCGTCGTCCCATTCGATTCATC
ATTCTCGATTTTACTCGAGTCTACGGAATCGACTTCTCGGCCGCAGAAGCATTCACCCGCATCAACCGCGTTCTT
CAAAAGCGCAACGTACAAACGGCCATATCCGGCTTGGATGTCGAAAGTGACGTAGGAAGGTCCCTACAAAATGTA
GGACTTTTCGAGCCAGAATCTGGCGTCCCTATCTTCGAAGACCTGAACTCAGCCCTTGAGTTCTGCGAGAACAAC
TACCTGAAAGTCTTCTACAACCGCCAGCAAGCACTTTCCACACCCACCGATTCAACTGCAAACTCCGAGCTCCTC
CAAATCCCCGCCTCAGTCCCCGTGCCCTCAGGACCCAAACCTATCACCCTAACCGACAACATTGTCAGCTCACCC
CGCCGCCAGCACCTACAGCGCGTGGCGACCTCAACCATCCAAGCCCACGAAACAACAATGATGGCCTCCCCCGCC
TGGTCCGCCATGCGCCAACCACTCCCACTCCTCCTCCAAACCTTCCAAGGCCTCTCAACCGAAAACGAAGACTTT
TGGTTCCCCGCCTGCGCCTACTTCTCCTGCGAATGCTACCCCGCCGGCACAGTCCTGTACCACGAAGGCGACGCC
CCGCGCGCCTTCTACCTCCTCGAGTCTGGCATGCTGCGCGCTGGCTACGACCTCCCACAGGGCCGCTACTTCGAG
CTCATTGTCGCTGGTCGACCGTGCGGCGAACTGCCTTTCTTCAGTGATACACGCCGCACGGCGACGGTCAAGGCC
GAGCGCGATTGTGTGGCTTGGTGTTTAACGGGGGCGCAGTGGAAGGTGCTACAGGAGAAAGAGCCGCGCATTGCT
CGTGAACTGTTGACGGTTAGCTTGAAGTTGACGACTGAGCGCATGGATAGTATCACCTCGTATGTTTTGACGATG
GCGGCTTGA
Gene >Pro_DTO377G3_2|g3634.t1
ATGGCGGTTTTGCAGCCTCGTGGCCGTCGCGACTCTCGTGCATCAGCGCTATCACGCAATCTGATGTTTGACCGC
GACATCCAGGGTAACGCCCCATCAGAAACGTTGGTGGAACATGCAAATCCAGGTAGCCCGCCCGGTCCAATGGGA
GCAGAATCATCCAGCTACAATGGATCAACGACAAGAACACCAAACCGTTCATTTTACCACCGGTCCTTCAATAGC
AATATGGGTGGGTCATTGTGCATACATAGTGCACGGCTAGAGATACCGCGCAATTTTTACTGACCATTCGACCTA
TCACAGATCCGGCTCATTATGCTTCAGGCGGTCTCCGTGACCAGACTGCGGAACTCGCTACCTATGGCCTTTCGC
TGAATAAGAATTCCCTCTTGAGGGACGGCTCCGGCTTACCCCCCACCCTTGATATATTCCACGGCAGACGGGATT
CTGCAAGTTACTCCCAGGACGAAGCTGCAAACCCTCAATCCGCAGCGGGGGAGGCGTTATTGGAGCCAGGGTATC
CCTCAGTTGACCCTGCTTCGGCTTCAGGTCCTTCGGCCTTGACAGAGATGATTCGCCGTCCGTTGACGGATACGG
AGGAGGACCAGGCCACACAACCCGGGACCGATGATATCTCCTTCCCCCCACCGATGATCTATGCGGAACCCGAAC
GAGACAATGAAAGCACCTCGTTATTATCTAAATCACGATCCAAATCTATACAAAACTATGGAAGTGCAAGTGACG
CTGAGAATCAAAGGGCGGCTGCACAACGATCTCCAAACTTAATAACGAAAGGAATTTCATCCGTCACCCATTATA
CTCGGATCTTGTCGAACCCAAAGGCATGGGATGGGCGAGCCATATGGAAAGATGCTGTGGTATACCCCGCAAGTC
TGGTTCCTGCCGTATTACTGGGTCTACTGCTCAACATTCTTGATGCTTTATCCTATGGAATGATCTTGTTCCCTC
TGGGAGAACCCCTGTTCGCTCACCTGGGAACTGACGGTATCTCGATGTTCTATGTCAGTACCATTATATCCCAAG
TGGTATTCTCCTGTGGAGGCTCGATCTTCAAAGGAGGAATAGGAAGTGAGATGATTGAAGTAGTACCCTTCTTCC
ACCAGATGGCTTTCACCATCATGAATTCAGTCGGCAAGGACAACCCGAAATCAGTGATTGCAACGACCATTCTAG
CCTTTTCGGTCAGTTCGGTTCTCACCGGCTTGGTGTTCTTCTTAATGGGTGTATGTGGGCTGGGCTCACTCATTG
GCTTCTTTCCCCGTCATATTCTCATCGGGTGCATCGGTGGTGTGGGCTACTTTCTTCTACAGACTGGAATGGAGG
TTTCAGCCCGGCTCCCCGGGTCTCTCGAGTACAACCTCCCCACGATTCAGAAACTTTTCACTCTCGATACTTTCC
CTCTTTGGATGATACCCCTCTTCCTTGCCATTGGACTTCTTGTTCTCAAACGATTTGTTCGCTCGAACTTCCTTG
TCGGCGGATACTTCATTGCCGTTGCTGCAGTGTTCTACATTGTCATCTTAAGCGCTAGGATTTCTATGGGCGCTC
TGCGCCACAATGGATGGGTCTTTGCTGCCCCGTCTTCGAACAACCCGTGGTATCATTTCTATTCTCTCTATGGTG
AGTCAATTGGTTGTAATTCTTCTGGCATTCCATGCTAATTCATTCCAGATCTCTCGGCGGTCAATTGGACTGCCT
TTGGTGAGACAATTCCGGCCATGTTCGCTTTGACATTCTTTGGTGTGCTTCATGTGCCCATCAACGTACCTGCTC
TCGGCATATCCACCGGCGAAGACAATCTCAACGTTGACAGAGAGCTCATGGCACATGGCGTGACGAATGCACTTT
CAGGATTCGCAGGAAGCATTCAGGTATGTGACCCCATCGCTAGAGCTGTGGTTAATGTGCTAACGGAAGCAGAAC
TATCTTGTTTATACCAACAGTCTTCTCTTCATTGCAAGTGGCGGGTCATCTCGGTTGGCTGGTCTGATGTTGGCC
GCAGCCACTGCAGGGATTATGGTCATTGGCCCAGTAATAATCGGCTTTATTCCTATTATGGTCGTTGGTGCCTTG
ATCTTCTTGTTGGGCATTGAGCTTTTGCAGGAGGCATTGGTGGACACATGGGGAAAACTCACCCGGCTTGAATAT
CTAACCGTTGTCATTATCGTTGTCACTATGGGCGCTTGGGACTTCGTGGTCGGAATCTTCATTGGGATCATTTTG
GCCTGTGTGAACTTTGTGGTCCAAACGTCTCGGAAATCTGCCATTCGAGCAACATTCTCGGGTGAAATTTCCGGG
TCAACGGTCCGACGTCCTCCTATCCAACAGGAGTTCCTACGCGAAGCTGGGCAGCAGACCCTGATTATCAAGCTT
GGTGGATATCTCTTTTTTGGGACCATCGTGAATGTCGAGAACACCATGCGTGGCCTGATCGAGGAGGAAGCTTTC
GACCGTCGTCCCATTCGATTCATCATTCTCGATTTTACTCGAGTCTACGGAATCGACTTCTCGGCCGCAGAAGCA
TTCACCCGCATCAACCGCGTTCTTCAAAAGCGCAACGTACAAACGGCCATATCCGGCTTGGATGTCGAAAGTGAC
GTAGGAAGGTCCCTACAAAATGTAGGACTTTTCGAGCCAGAATCTGGCGTCCCTATCTTCGAAGACCTGAACTCA
GCCCTTGAGTTCTGCGAGAACAACTACCTGAAAGTCTTCTACAACCGCCAGCAAGCACTTTCCACACCCACCGAT
TCAACTGCAAACTCCGAGCTCCTCCAAATCCCCGCCTCAGTCCCCGTGCCCTCAGGACCCAAACCTATCACCCTA
ACCGACAACATTGTCAGCTCACCCCGCCGCCAGCACCTACAGCGCGTGGCGACCTCAACCATCCAAGCCCACGAA
ACAACAATGATGGCCTCCCCCGCCTGGTCCGCCATGCGCCAACCACTCCCACTCCTCCTCCAAACCTTCCAAGGC
CTCTCAACCGAAAACGAAGACTTTTGGTTCCCCGCCTGCGCCTACTTCTCCTGCGAATGCTACCCCGCCGGCACA
GTCCTGTACCACGAAGGCGACGCCCCGCGCGCCTTCTACCTCCTCGAGTCTGGCATGCTGCGCGCTGGCTACGAC
CTCCCACAGGGCCGCTACTTCGAGCTCATTGTCGCTGGTCGACCGTGCGGCGAACTGCCTTTCTTCAGTGATACA
CGCCGCACGGCGACGGTCAAGGCCGAGCGCGATTGTGTGGCTTGGTGTTTAACGGGGGCGCAGTGGAAGGTGCTA
CAGGAGAAAGAGCCGCGCATTGCTCGTGAACTGTTGACGGTTAGCTTGAAGTTGACGACTGAGCGCATGGATAGT
ATCACCTCGTATGTTTTGACGATGGCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail