Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g3625.t1
Gene name
Locationscaffold_06:251022..256502
Strand-
Gene length (bp)5480
Transcript length (bp)5151
Coding sequence length (bp)5151
Protein length (aa) 1717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08696 Dna2 DNA replication factor Dna2 7.1E-67 627 829
PF13087 AAA_12 AAA domain 5.8E-51 1367 1595
PF13086 AAA_11 AAA domain 1.2E-14 1190 1285
PF13086 AAA_11 AAA domain 6.8E-16 1292 1358
PF13604 AAA_30 AAA domain 2.1E-14 1190 1358
PF13245 AAA_19 AAA domain 6.7E-12 1194 1354
PF12705 PDDEXK_1 PD-(D/E)XK nuclease superfamily 1.9E-07 681 938
PF01930 Cas_Cas4 Domain of unknown function DUF83 4.4E-07 835 939

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g3625.t1
MLQGAGLAIRFIFPYARLKNIRTSSFYTECILTDFERVIGYFRIEAMATNNAYPISSNSRTKLSAFRFQEGEVVP
DGASSKDETTSVNGNKQHEDPGSNSVREPMQTSSDKGYSPPLEAQAPEPQLQESKPIKECPQTPGNKIPLADLIS
NAEDSFNPAEVPEMTPVDQVIWQHVPASSNPDTSSQTPAGRRRKRRHSSSPTGSPSKGTKKKVQKEPFDLNSIQV
LFKTPQHDMAAELWSNYMDKNMVDGPDDLPPPRFANLLSSSPQTPGSSRTSRDSSGLRRAISCTTDFPTSRTKRR
RVNGLDVSRGIFQRTNSNVESERPKSSRINYLMEKIERSIYMATADAGPPGSSPLRQHVDTRRCRSSSPTKNWRL
HEADEETTESPCAVPPGKVRTGKLPSLQESSDEFGDDDLDQGLLDLVNASEDPFIEPAHASTEFVSLGSSEWAGL
DAEKSRSWQPEDSMLNSKPLMTIPHSTTTNETKRDDIDEFDEFEYEYDDLPDNLQEILAKCDTKPVPVNLLNSTA
AGPSLQRSDTMNTPVNGSMHSKPPTAIPVKPEVASSDDEFDDDFDLEAIEQTMKQAGEGGLAHNLKGRQAIKRYR
VVEITKSTYVTPKGRTQPEQGLLVEDEKTRDRKSIILRESWFDTPCSKDSYIHLVGDFNAAGQCIVDNLNHMIIL
HPDHLISATVVADSVDCQRRAVLQDRVKVIGALERPQAFGVFFHEVFQEALKANKWDMKSLKTLVETVLGRHIEE
LYSIQMSIPEAVEYLMSRMPAVLDWADAFLHLKPQANSMVEDRNNSKLNLSINKLLEVEEHIWSPMYGLKGNIDA
TVQVTCREDEMEKNLVVPLELKTGRRDTSQSHRAQTALYTLLLSDRYDIDVTFGLLYYLELTKTLSIRAVRHELL
QMIQVRNHLSGYIRERQQLPPMLKKARQCIRCYAKTPCLIYHKLSEDGDGETSALGEDFDAVVGHLDNGDRDFFR
KWDELLTKEEGNIVKFRRELWTLLSSEREALGRCFGDVVIDPHSAYEEKTGTRINRYHYTFVKRQASPGFSFAES
QISVGEPIVISDEKGHFALTNGYVLHTSSSHIKVGVDRKLHNARSKTTGFDEVTNQSFRGIMEIGTEEPAALQSP
DEQLVYRIDKDEFSNGMAIVRNNLICMMDKDLFQARQLRQLIVQGQAPAFKTMSSSYSISDPGNLNVDQRQAIDK
VMSAKDYALVLGMPGTGKTTTIAHIIRALVSQGKSVLLTSYTHTAVDNILLKIRDDNIRVLRIGATAKIHPDVQK
FADLAAVQKSTIEELKDSYEKPQVVATTCLGINHNIFNQRIFDYCIVDEASQITLPVCLGPIRMARTFILVGDHY
QLPPLVQNKAAQEGGLDISLFKLLSDAQPGSVVNLEHQYRMCEEIMLLSNTLIYSGRLKCGTPQVAARSLDIPDI
NALEKFHVEDLSHALSQSTREICPGVPSSPCWLRDLLTPSAKTRLVNTDPIGPAALEIAQGNRVVNHMEVFLCSQ
LVESFIACGIPARDIGVITFYRSQLSLIRQSLRRYGPDLEMHTTDKFQGRDKAVIILSCVRSNAENNVGELLRDW
RRVNVAFTRAQTKLLVVGSRSTLRDGNELLCKYVRLMESKNWVYNLPSGAIEKHFFPSCTTQSQLMSPGAALTPR
STKGKGNGKNKLPPSRSSREPLSPLGSRQAAPGLRKPSKTGAKLFNGTKVVGNRPILRDIVNDLTG*
Coding >Pro_DTO377G3_2|g3625.t1
ATGCTGCAGGGCGCTGGACTCGCCATTCGTTTCATCTTTCCATATGCACGACTCAAGAACATTCGAACCTCCAGC
TTCTACACGGAATGTATCCTTACCGATTTTGAGCGCGTCATTGGATATTTCCGAATCGAAGCAATGGCAACAAAC
AATGCATACCCCATATCTTCAAACTCACGAACAAAGTTGAGCGCTTTTCGCTTCCAGGAAGGCGAAGTAGTTCCC
GACGGCGCCAGCTCGAAAGACGAGACGACATCAGTCAATGGGAACAAACAACATGAGGATCCGGGCTCTAACAGT
GTGAGGGAGCCGATGCAGACTTCTTCTGATAAAGGATATTCTCCGCCTCTCGAAGCTCAAGCACCGGAACCCCAA
TTACAAGAATCAAAGCCGATTAAAGAATGCCCTCAGACTCCGGGAAACAAGATACCTCTGGCAGATTTGATCAGC
AATGCTGAGGATTCGTTTAATCCTGCCGAAGTCCCGGAAATGACGCCAGTTGATCAAGTCATCTGGCAGCATGTG
CCTGCCAGCTCGAACCCAGACACCTCGTCCCAGACACCAGCGGGTCGTCGTAGGAAGCGCCGGCACAGCTCTTCG
CCTACTGGCTCTCCCTCGAAAGGGACTAAGAAAAAGGTGCAAAAAGAACCCTTTGATCTTAATTCAATACAAGTC
CTATTCAAGACACCGCAGCATGATATGGCCGCTGAATTGTGGAGTAACTACATGGATAAAAACATGGTCGATGGC
CCGGATGATCTTCCGCCGCCACGGTTCGCAAATCTTCTTTCCTCCTCACCCCAGACACCAGGTTCGAGCAGAACA
AGTCGAGACTCGTCAGGGCTGAGACGCGCGATTAGCTGCACCACCGATTTCCCCACCTCTCGAACAAAACGGCGA
CGAGTCAATGGACTAGATGTCAGCCGTGGCATATTTCAACGAACTAACAGCAATGTCGAATCTGAGAGACCCAAG
TCCTCCAGGATCAACTATCTTATGGAGAAAATTGAAAGAAGCATATACATGGCCACTGCCGATGCGGGTCCACCT
GGATCGTCACCCCTACGCCAACATGTGGATACACGGAGGTGCCGATCGTCTTCACCCACGAAGAACTGGAGGCTT
CACGAGGCCGACGAAGAAACCACTGAATCCCCATGTGCTGTACCACCTGGGAAGGTGAGAACTGGGAAACTGCCC
AGTCTTCAAGAGTCGTCCGACGAGTTCGGAGACGATGATCTTGATCAAGGTCTTCTGGACCTGGTTAATGCCTCG
GAGGATCCTTTCATTGAGCCGGCACATGCATCTACCGAGTTTGTGTCTCTGGGGTCTTCTGAATGGGCTGGCCTT
GACGCAGAAAAGTCTCGTTCATGGCAGCCTGAAGATTCAATGCTCAACAGCAAGCCTCTCATGACAATACCCCAT
AGCACTACGACTAACGAAACAAAACGCGATGATATCGATGAATTCGATGAATTTGAATATGAATACGATGATCTG
CCTGACAACTTGCAGGAAATACTTGCAAAATGTGATACAAAGCCCGTTCCGGTCAATCTATTGAATTCAACGGCC
GCTGGACCATCTTTGCAGAGATCAGATACAATGAATACCCCGGTGAATGGCAGTATGCATAGCAAACCCCCAACC
GCCATACCTGTCAAACCTGAGGTGGCATCATCGGATGATGAGTTTGATGATGATTTTGATCTGGAAGCCATTGAG
CAAACTATGAAGCAAGCAGGTGAAGGTGGACTCGCTCATAACCTCAAAGGTCGCCAAGCTATCAAACGTTACCGG
GTCGTTGAGATCACGAAGAGCACATATGTTACTCCGAAAGGACGTACTCAGCCAGAGCAGGGCTTGCTAGTTGAA
GACGAGAAAACCCGAGACCGCAAGTCTATTATCTTGCGAGAGTCATGGTTCGACACTCCCTGCAGCAAGGATTCG
TATATCCACCTAGTCGGGGACTTCAACGCAGCCGGCCAATGCATTGTGGATAATTTGAACCACATGATCATTCTT
CACCCCGACCATCTCATTTCAGCTACGGTCGTAGCAGACTCGGTAGACTGCCAGCGACGAGCTGTGCTTCAAGAT
CGAGTCAAAGTCATTGGCGCACTCGAGCGACCGCAAGCCTTTGGAGTGTTTTTCCACGAAGTTTTTCAAGAAGCT
CTCAAAGCGAACAAATGGGATATGAAGTCATTGAAGACATTGGTCGAAACCGTCCTGGGCAGACACATCGAAGAG
CTGTACTCGATTCAAATGAGTATCCCAGAAGCTGTTGAATATCTCATGAGCAGGATGCCTGCTGTTCTAGACTGG
GCAGATGCTTTCCTGCATCTCAAGCCACAGGCCAATTCTATGGTTGAAGACCGCAATAACTCTAAGCTGAACTTG
AGTATCAATAAACTGCTTGAGGTAGAGGAGCACATCTGGTCCCCAATGTATGGCCTCAAAGGCAATATCGATGCG
ACGGTACAAGTCACTTGCCGTGAAGATGAAATGGAGAAGAACCTGGTGGTTCCGCTGGAACTCAAGACTGGGCGA
AGGGATACAAGCCAGTCACATAGGGCCCAAACAGCTCTCTACACTCTCCTCCTGTCGGATCGCTATGATATCGAT
GTTACATTTGGGCTTCTCTACTACCTCGAGTTAACGAAAACACTCAGCATCCGTGCGGTTCGACACGAACTGCTC
CAGATGATCCAGGTGCGCAATCACCTCTCTGGCTATATTCGTGAGAGGCAGCAGCTTCCACCGATGCTGAAAAAA
GCTCGTCAATGTATTCGATGCTATGCCAAGACTCCTTGTCTCATCTATCACAAGCTCTCCGAGGATGGCGATGGC
GAGACCAGTGCACTTGGCGAGGATTTCGATGCAGTTGTTGGTCACCTGGACAACGGTGATCGGGACTTCTTTCGC
AAATGGGATGAACTTCTCACCAAAGAAGAAGGTAATATCGTGAAGTTCCGGCGAGAACTTTGGACATTGCTGAGT
AGCGAGCGAGAAGCCCTGGGTCGATGCTTCGGGGATGTCGTTATCGACCCGCATTCTGCGTATGAGGAGAAGACT
GGGACAAGGATCAATCGCTACCATTATACGTTCGTTAAAAGACAAGCGTCTCCTGGTTTCTCCTTTGCTGAATCC
CAAATATCTGTCGGTGAACCAATTGTCATTTCGGATGAGAAGGGCCATTTTGCTCTCACCAATGGATACGTGCTG
CATACTAGTTCGTCACACATCAAGGTTGGCGTGGACCGGAAACTTCACAATGCACGATCAAAGACGACTGGCTTC
GATGAAGTCACAAATCAGTCTTTCAGGGGAATCATGGAGATTGGGACAGAAGAGCCTGCTGCCCTGCAGAGCCCA
GACGAGCAGCTCGTTTACCGGATCGACAAAGATGAGTTTAGCAACGGCATGGCCATTGTTCGAAATAATCTCATC
TGTATGATGGATAAAGACTTGTTCCAAGCGAGGCAGCTTCGACAGCTCATTGTTCAGGGGCAGGCGCCTGCCTTC
AAGACGATGTCGTCTTCATACTCGATCTCCGATCCTGGCAATCTCAACGTAGACCAAAGACAAGCCATTGACAAA
GTGATGAGCGCCAAAGACTATGCTCTTGTCCTTGGAATGCCTGGGACTGGCAAGACCACGACCATTGCTCATATC
ATTAGGGCCCTTGTTTCTCAAGGCAAGAGTGTTCTTCTTACGTCTTACACCCACACTGCCGTCGACAACATTCTG
CTGAAGATTCGAGACGACAACATCCGTGTACTGCGTATAGGTGCAACCGCCAAAATTCATCCAGATGTTCAGAAA
TTTGCCGATCTTGCCGCAGTCCAAAAATCAACCATTGAAGAACTTAAGGATTCATACGAAAAGCCGCAGGTCGTT
GCCACTACTTGTCTCGGAATCAACCATAACATTTTCAACCAACGCATTTTTGACTATTGTATTGTCGACGAAGCA
TCGCAGATCACGCTCCCAGTCTGCCTCGGCCCGATTCGTATGGCAAGGACTTTCATCCTGGTGGGTGATCACTAT
CAATTGCCGCCGCTTGTGCAGAATAAAGCGGCCCAGGAAGGAGGACTTGATATCAGTCTCTTCAAACTACTATCG
GATGCACAACCAGGTTCGGTTGTCAACCTAGAGCATCAGTACCGCATGTGTGAGGAAATCATGTTACTTTCAAAC
ACTCTGATTTACTCGGGCCGTCTCAAATGCGGCACGCCGCAGGTAGCAGCCCGATCTTTGGATATACCCGACATC
AACGCACTAGAGAAATTCCATGTCGAGGACTTGAGTCATGCTCTGTCACAGTCAACCCGAGAAATATGCCCGGGT
GTCCCCAGTAGCCCGTGTTGGCTCCGAGACTTACTGACGCCATCTGCGAAGACCCGCCTGGTCAACACCGATCCC
ATCGGCCCCGCAGCCCTCGAGATAGCACAGGGAAACCGTGTCGTGAATCACATGGAGGTCTTCCTTTGCTCGCAA
CTTGTGGAGTCATTCATTGCCTGTGGTATTCCCGCGCGCGACATTGGTGTGATCACTTTCTACCGCAGTCAACTC
TCGCTCATTCGCCAGAGCCTGCGACGCTACGGCCCAGATCTGGAAATGCACACCACAGACAAGTTCCAAGGCCGC
GACAAAGCGGTCATCATTTTGAGCTGCGTCCGCAGTAACGCCGAAAACAACGTCGGCGAGCTACTGCGCGACTGG
CGCCGTGTCAACGTCGCCTTCACCCGCGCCCAGACCAAGCTCCTCGTTGTCGGCAGCAGATCCACTCTCCGTGAT
GGCAACGAGCTCCTCTGCAAATATGTGCGCCTGATGGAAAGCAAAAATTGGGTTTATAACTTGCCCAGCGGAGCG
ATAGAGAAGCATTTCTTCCCCTCTTGTACCACACAATCGCAGCTCATGTCTCCGGGTGCGGCTTTGACTCCTCGC
TCTACCAAGGGCAAAGGTAATGGCAAGAACAAATTGCCTCCTTCGCGTTCTTCCCGTGAACCACTGAGCCCATTG
GGCTCCCGACAAGCAGCGCCCGGTCTACGAAAGCCTTCCAAGACAGGTGCAAAGTTGTTCAACGGCACGAAGGTG
GTTGGGAATCGGCCCATCTTACGAGACATAGTGAATGACTTGACGGGCTAG
Transcript >Pro_DTO377G3_2|g3625.t1
ATGCTGCAGGGCGCTGGACTCGCCATTCGTTTCATCTTTCCATATGCACGACTCAAGAACATTCGAACCTCCAGC
TTCTACACGGAATGTATCCTTACCGATTTTGAGCGCGTCATTGGATATTTCCGAATCGAAGCAATGGCAACAAAC
AATGCATACCCCATATCTTCAAACTCACGAACAAAGTTGAGCGCTTTTCGCTTCCAGGAAGGCGAAGTAGTTCCC
GACGGCGCCAGCTCGAAAGACGAGACGACATCAGTCAATGGGAACAAACAACATGAGGATCCGGGCTCTAACAGT
GTGAGGGAGCCGATGCAGACTTCTTCTGATAAAGGATATTCTCCGCCTCTCGAAGCTCAAGCACCGGAACCCCAA
TTACAAGAATCAAAGCCGATTAAAGAATGCCCTCAGACTCCGGGAAACAAGATACCTCTGGCAGATTTGATCAGC
AATGCTGAGGATTCGTTTAATCCTGCCGAAGTCCCGGAAATGACGCCAGTTGATCAAGTCATCTGGCAGCATGTG
CCTGCCAGCTCGAACCCAGACACCTCGTCCCAGACACCAGCGGGTCGTCGTAGGAAGCGCCGGCACAGCTCTTCG
CCTACTGGCTCTCCCTCGAAAGGGACTAAGAAAAAGGTGCAAAAAGAACCCTTTGATCTTAATTCAATACAAGTC
CTATTCAAGACACCGCAGCATGATATGGCCGCTGAATTGTGGAGTAACTACATGGATAAAAACATGGTCGATGGC
CCGGATGATCTTCCGCCGCCACGGTTCGCAAATCTTCTTTCCTCCTCACCCCAGACACCAGGTTCGAGCAGAACA
AGTCGAGACTCGTCAGGGCTGAGACGCGCGATTAGCTGCACCACCGATTTCCCCACCTCTCGAACAAAACGGCGA
CGAGTCAATGGACTAGATGTCAGCCGTGGCATATTTCAACGAACTAACAGCAATGTCGAATCTGAGAGACCCAAG
TCCTCCAGGATCAACTATCTTATGGAGAAAATTGAAAGAAGCATATACATGGCCACTGCCGATGCGGGTCCACCT
GGATCGTCACCCCTACGCCAACATGTGGATACACGGAGGTGCCGATCGTCTTCACCCACGAAGAACTGGAGGCTT
CACGAGGCCGACGAAGAAACCACTGAATCCCCATGTGCTGTACCACCTGGGAAGGTGAGAACTGGGAAACTGCCC
AGTCTTCAAGAGTCGTCCGACGAGTTCGGAGACGATGATCTTGATCAAGGTCTTCTGGACCTGGTTAATGCCTCG
GAGGATCCTTTCATTGAGCCGGCACATGCATCTACCGAGTTTGTGTCTCTGGGGTCTTCTGAATGGGCTGGCCTT
GACGCAGAAAAGTCTCGTTCATGGCAGCCTGAAGATTCAATGCTCAACAGCAAGCCTCTCATGACAATACCCCAT
AGCACTACGACTAACGAAACAAAACGCGATGATATCGATGAATTCGATGAATTTGAATATGAATACGATGATCTG
CCTGACAACTTGCAGGAAATACTTGCAAAATGTGATACAAAGCCCGTTCCGGTCAATCTATTGAATTCAACGGCC
GCTGGACCATCTTTGCAGAGATCAGATACAATGAATACCCCGGTGAATGGCAGTATGCATAGCAAACCCCCAACC
GCCATACCTGTCAAACCTGAGGTGGCATCATCGGATGATGAGTTTGATGATGATTTTGATCTGGAAGCCATTGAG
CAAACTATGAAGCAAGCAGGTGAAGGTGGACTCGCTCATAACCTCAAAGGTCGCCAAGCTATCAAACGTTACCGG
GTCGTTGAGATCACGAAGAGCACATATGTTACTCCGAAAGGACGTACTCAGCCAGAGCAGGGCTTGCTAGTTGAA
GACGAGAAAACCCGAGACCGCAAGTCTATTATCTTGCGAGAGTCATGGTTCGACACTCCCTGCAGCAAGGATTCG
TATATCCACCTAGTCGGGGACTTCAACGCAGCCGGCCAATGCATTGTGGATAATTTGAACCACATGATCATTCTT
CACCCCGACCATCTCATTTCAGCTACGGTCGTAGCAGACTCGGTAGACTGCCAGCGACGAGCTGTGCTTCAAGAT
CGAGTCAAAGTCATTGGCGCACTCGAGCGACCGCAAGCCTTTGGAGTGTTTTTCCACGAAGTTTTTCAAGAAGCT
CTCAAAGCGAACAAATGGGATATGAAGTCATTGAAGACATTGGTCGAAACCGTCCTGGGCAGACACATCGAAGAG
CTGTACTCGATTCAAATGAGTATCCCAGAAGCTGTTGAATATCTCATGAGCAGGATGCCTGCTGTTCTAGACTGG
GCAGATGCTTTCCTGCATCTCAAGCCACAGGCCAATTCTATGGTTGAAGACCGCAATAACTCTAAGCTGAACTTG
AGTATCAATAAACTGCTTGAGGTAGAGGAGCACATCTGGTCCCCAATGTATGGCCTCAAAGGCAATATCGATGCG
ACGGTACAAGTCACTTGCCGTGAAGATGAAATGGAGAAGAACCTGGTGGTTCCGCTGGAACTCAAGACTGGGCGA
AGGGATACAAGCCAGTCACATAGGGCCCAAACAGCTCTCTACACTCTCCTCCTGTCGGATCGCTATGATATCGAT
GTTACATTTGGGCTTCTCTACTACCTCGAGTTAACGAAAACACTCAGCATCCGTGCGGTTCGACACGAACTGCTC
CAGATGATCCAGGTGCGCAATCACCTCTCTGGCTATATTCGTGAGAGGCAGCAGCTTCCACCGATGCTGAAAAAA
GCTCGTCAATGTATTCGATGCTATGCCAAGACTCCTTGTCTCATCTATCACAAGCTCTCCGAGGATGGCGATGGC
GAGACCAGTGCACTTGGCGAGGATTTCGATGCAGTTGTTGGTCACCTGGACAACGGTGATCGGGACTTCTTTCGC
AAATGGGATGAACTTCTCACCAAAGAAGAAGGTAATATCGTGAAGTTCCGGCGAGAACTTTGGACATTGCTGAGT
AGCGAGCGAGAAGCCCTGGGTCGATGCTTCGGGGATGTCGTTATCGACCCGCATTCTGCGTATGAGGAGAAGACT
GGGACAAGGATCAATCGCTACCATTATACGTTCGTTAAAAGACAAGCGTCTCCTGGTTTCTCCTTTGCTGAATCC
CAAATATCTGTCGGTGAACCAATTGTCATTTCGGATGAGAAGGGCCATTTTGCTCTCACCAATGGATACGTGCTG
CATACTAGTTCGTCACACATCAAGGTTGGCGTGGACCGGAAACTTCACAATGCACGATCAAAGACGACTGGCTTC
GATGAAGTCACAAATCAGTCTTTCAGGGGAATCATGGAGATTGGGACAGAAGAGCCTGCTGCCCTGCAGAGCCCA
GACGAGCAGCTCGTTTACCGGATCGACAAAGATGAGTTTAGCAACGGCATGGCCATTGTTCGAAATAATCTCATC
TGTATGATGGATAAAGACTTGTTCCAAGCGAGGCAGCTTCGACAGCTCATTGTTCAGGGGCAGGCGCCTGCCTTC
AAGACGATGTCGTCTTCATACTCGATCTCCGATCCTGGCAATCTCAACGTAGACCAAAGACAAGCCATTGACAAA
GTGATGAGCGCCAAAGACTATGCTCTTGTCCTTGGAATGCCTGGGACTGGCAAGACCACGACCATTGCTCATATC
ATTAGGGCCCTTGTTTCTCAAGGCAAGAGTGTTCTTCTTACGTCTTACACCCACACTGCCGTCGACAACATTCTG
CTGAAGATTCGAGACGACAACATCCGTGTACTGCGTATAGGTGCAACCGCCAAAATTCATCCAGATGTTCAGAAA
TTTGCCGATCTTGCCGCAGTCCAAAAATCAACCATTGAAGAACTTAAGGATTCATACGAAAAGCCGCAGGTCGTT
GCCACTACTTGTCTCGGAATCAACCATAACATTTTCAACCAACGCATTTTTGACTATTGTATTGTCGACGAAGCA
TCGCAGATCACGCTCCCAGTCTGCCTCGGCCCGATTCGTATGGCAAGGACTTTCATCCTGGTGGGTGATCACTAT
CAATTGCCGCCGCTTGTGCAGAATAAAGCGGCCCAGGAAGGAGGACTTGATATCAGTCTCTTCAAACTACTATCG
GATGCACAACCAGGTTCGGTTGTCAACCTAGAGCATCAGTACCGCATGTGTGAGGAAATCATGTTACTTTCAAAC
ACTCTGATTTACTCGGGCCGTCTCAAATGCGGCACGCCGCAGGTAGCAGCCCGATCTTTGGATATACCCGACATC
AACGCACTAGAGAAATTCCATGTCGAGGACTTGAGTCATGCTCTGTCACAGTCAACCCGAGAAATATGCCCGGGT
GTCCCCAGTAGCCCGTGTTGGCTCCGAGACTTACTGACGCCATCTGCGAAGACCCGCCTGGTCAACACCGATCCC
ATCGGCCCCGCAGCCCTCGAGATAGCACAGGGAAACCGTGTCGTGAATCACATGGAGGTCTTCCTTTGCTCGCAA
CTTGTGGAGTCATTCATTGCCTGTGGTATTCCCGCGCGCGACATTGGTGTGATCACTTTCTACCGCAGTCAACTC
TCGCTCATTCGCCAGAGCCTGCGACGCTACGGCCCAGATCTGGAAATGCACACCACAGACAAGTTCCAAGGCCGC
GACAAAGCGGTCATCATTTTGAGCTGCGTCCGCAGTAACGCCGAAAACAACGTCGGCGAGCTACTGCGCGACTGG
CGCCGTGTCAACGTCGCCTTCACCCGCGCCCAGACCAAGCTCCTCGTTGTCGGCAGCAGATCCACTCTCCGTGAT
GGCAACGAGCTCCTCTGCAAATATGTGCGCCTGATGGAAAGCAAAAATTGGGTTTATAACTTGCCCAGCGGAGCG
ATAGAGAAGCATTTCTTCCCCTCTTGTACCACACAATCGCAGCTCATGTCTCCGGGTGCGGCTTTGACTCCTCGC
TCTACCAAGGGCAAAGGTAATGGCAAGAACAAATTGCCTCCTTCGCGTTCTTCCCGTGAACCACTGAGCCCATTG
GGCTCCCGACAAGCAGCGCCCGGTCTACGAAAGCCTTCCAAGACAGGTGCAAAGTTGTTCAACGGCACGAAGGTG
GTTGGGAATCGGCCCATCTTACGAGACATAGTGAATGACTTGACGGGCTAG
Gene >Pro_DTO377G3_2|g3625.t1
ATGCTGCAGGGCGCTGGACTCGCCATTCGTTTCATCTTTCCATATGCACGACTCAAGAACATTCGAAGTAACTGA
ACCGGTAAATACCATCTTTTAACTGGTATGTTTTATCTCAGACCCCCAAAATATCCCCATTTCTGACACCGTCCT
ACTCAGCCTCCAGCTTCTACACGGAATGTATCCTTACCGATTTTGAGCGCGTCATTGGATATTTCCGAATCGAAG
CAATGGCAACAAACAATGCATACCCCATATCTTCAAACTCACGAACAAAGTTGAGCGCTTTTCGCTTCCAGGAAG
GCGAAGTAGTTCCCGACGGCGCCAGCTCGAAAGACGAGACGACATCAGTCAATGGGAACAAACAACATGAGGATC
CGGGCTCTAACAGTGTGAGGGAGCCGATGCAGACTTCTTCTGATAAAGGATATTCTCCGCCTCTCGAAGCTCAAG
CACCGGAACCCCAATTACAAGAATCAAAGCCGATTAAAGAATGCCCTCAGACTCCGGGAAACAAGATACCTCTGG
CAGATTTGATCAGCAATGCTGAGGATTCGTTTAATCCTGCCGAAGTCCCGGAAATGACGCCAGTTGATCAAGTCA
TCTGGCAGCATGTGCCTGCCAGCTCGAACCCAGACACCTCGTCCCAGACACCAGCGGGTCGTCGTAGGAAGCGCC
GGCACAGCTCTTCGCCTACTGGCTCTCCCTCGAAAGGGACTAAGAAAAAGGTGCAAAAAGAACCCTTTGATCTTA
ATTCAATACAAGTCCTATTCAAGACACCGCAGCATGATATGGCCGCTGAATTGTGGAGTAACTACATGGATAAAA
ACATGGTCGATGGCCCGGATGATCTTCCGCCGCCACGGTTCGCAAATCTTCTTTCCTCCTCACCCCAGACACCAG
GTTCGAGCAGAACAAGTCGAGACTCGTCAGGGCTGAGACGCGCGATTAGCTGCACCACCGATTTCCCCACCTCTC
GAACAAAACGGCGACGAGTCAATGGACTAGATGTCAGCCGTGGCATATTTCAACGAACTAACAGCAATGTCGAAT
CTGAGAGACCCAAGTCCTCCAGGATCAACTATCTTATGGAGAAAATTGAAAGAAGCATATACATGGCCACTGCCG
ATGCGGGTCCACCTGGATCGTCACCCCTACGCCAACATGTGGATACACGGAGGTGCCGATCGTCTTCACCCACGA
AGAACTGGAGGCTTCACGAGGCCGACGAAGAAACCACTGAATCCCCATGTGCTGTACCACCTGGGAAGGTGAGAA
CTGGGAAACTGCCCAGTCTTCAAGAGTCGTCCGACGAGTTCGGAGACGATGATCTTGATCAAGGTCTTCTGGACC
TGGTTAATGCCTCGGAGGATCCTTTCATTGAGCCGGCACATGCATCTACCGAGTTTGTGTCTCTGGGGTCTTCTG
AATGGGCTGGCCTTGACGCAGAAAAGTCTCGTTCATGGCAGCCTGAAGATTCAATGCTCAACAGCAAGCCTCTCA
TGACAATACCCCATAGCACTACGACTAACGAAACAAAACGCGATGATATCGATGAATTCGATGAATTTGAATATG
AATACGATGATCTGCCTGACAACTTGCAGGAAATACTTGCAAAATGTGATACAAAGCCCGTTCCGGTCAATCTAT
TGAATTCAACGGCCGCTGGACCATCTTTGCAGAGATCAGATACAATGAATACCCCGGTGAATGGCAGTATGCATA
GCAAACCCCCAACCGCCATACCTGTCAAACCTGAGGTGGCATCATCGGATGATGAGTTTGATGATGATTTTGATC
TGGAAGCCATTGAGCAAACTATGAAGCAAGCAGGTGAAGGTGGACTCGCTCATGTTCGTCACTCTTAGTCAGTTA
ATTTTTAGATATATGCTAAGACAGTCAAAACAAATAGAACCTCAAAGGTCGCCAAGCTATCAAACGTTACCGGGT
CGTTGAGATCACGAAGAGCACATATGTTACTCCGAAAGGACGTACTCAGCCAGAGCAGGTCAGATACATTGCCCT
TGCCTAGGATATAGTCCCGTCCGCTGACTTTGAGTACAGGGCTTGCTAGTTGAAGACGAGAAAACCCGAGACCGC
AAGTCTATTATCTTGCGAGAGTCATGGTTCGACACTCCCTGCAGCAAGGATTCGTATATCCACCTAGTCGGGGAC
TTCAACGCAGCCGGCCAATGCATTGTGGATAATTTGAACCACATGATCATTCTTCACCCCGACCATCTCATTTCA
GCTACGGTCGTAGCAGACTCGGTAGACTGCCAGCGACGAGCTGTGCTTCAAGATCGAGTCAAAGTCATTGGCGCA
CTCGAGCGACCGCAAGCCTTTGGAGTGTTTTTCCACGAAGTTTTTCAAGAAGCTCTCAAAGCGAACAAATGGGAT
ATGAAGTCATTGAAGACATTGGTCGAAACCGTCCTGGGCAGACACATCGAAGAGCTGTACTCGATTCAAATGAGT
ATCCCAGAAGCTGTTGAATATCTCATGAGCAGGATGCCTGCTGTTCTAGACTGGGCAGATGCTTTCCTGCATCTC
AAGCCACAGGTACGTCTCACGGCCGCTGGATGGGCGAAAGAGGCCAAGAAACCTTGCTAACCAAGATCAATAGGC
CAATTCTATGGTTGAAGACCGCAATAACTCTAAGCTGAACTTGAGTATCAATAAACTGCTTGAGGTAGAGGAGCA
CATCTGGTCCCCAATGTATGGCCTCAAAGGCAATATCGATGCGACGGTACAAGTCACTTGCCGTGAAGATGAAAT
GGAGAAGAACCTGGTGGTTCCGCTGGAACTCAAGACTGGGCGAAGGGATACAAGCCAGTCACATAGGGCCCAAAC
AGCTCTCTACACTCTCCTCCTGTCGGATCGCTATGGTAAGTAATGAGGCCTCCGATCCTATTCCGACTAATTGAC
TAATTGCTAAAATTATCGCAGATATCGATGTTACATTTGGGCTTCTCTACTACCTCGAGTTAACGAAAACACTCA
GCATCCGTGCGGTTCGACACGAACTGCTCCAGATGATCCAGGTGCGCAATCACCTCTCTGGCTATATTCGTGAGA
GGCAGCAGCTTCCACCGATGCTGAAAAAAGCTCGTCAATGTATTCGATGCTATGCCAAGACTCCTTGTCTCATCT
ATCACAAGCTCTCCGAGGATGGCGATGGCGAGACCAGTGCACTTGGCGAGGATTTCGATGCAGTTGTTGGTCACC
TGGACAACGGTGATCGGGACTTCTTTCGCAAATGGGATGAACTTCTCACCAAAGAAGAAGGTAATATCGTGAAGT
TCCGGCGAGAACTTTGGACATTGCTGAGTAGCGAGCGAGAAGCCCTGGGTCGATGCTTCGGGGATGTCGTTATCG
ACCCGCATTCTGCGTATGAGGAGAAGACTGGGACAAGGATCAATCGCTACCATTATACGTTCGTTAAAAGACAAG
CGTCTCCTGGTTTCTCCTTTGCTGAATCCCAAATATCTGTCGGTGAACCAATTGTCATTTCGGATGAGAAGGGCC
ATTTTGCTCTCACCAATGGATACGTGCTGCATACTAGTTCGTCACACATCAAGGTTGGCGTGGACCGGAAACTTC
ACAATGCACGATCAAAGACGACTGGCTTCGATGAAGTCACAAATCAGTCTTTCAGGGGAATCATGGAGATTGGGA
CAGAAGAGCCTGCTGCCCTGCAGAGCCCAGACGAGCAGCTCGTTTACCGGATCGACAAAGATGAGTTTAGCAACG
GCATGGCCATTGTTCGAAATAATCTCATCTGTATGATGGATAAAGACTTGTTCCAAGCGAGGCAGCTTCGACAGC
TCATTGTTCAGGGGCAGGCGCCTGCCTTCAAGACGATGTCGTCTTCATACTCGATCTCCGATCCTGGCAATCTCA
ACGTAGACCAAAGACAAGCCATTGACAAAGTGATGAGCGCCAAAGACTATGCTCTTGTCCTTGGAATGCCTGGGA
CTGGCAAGACCACGACCATTGCTCATATCATTAGGGCCCTTGTTTCTCAAGGCAAGAGTGTTCTTCTTACGTCTT
ACACCCACACTGCCGTCGACAACATTCTGCTGAAGATTCGAGACGACAACATCCGTGTACTGCGTATAGGTGCAA
CCGCCAAAATTCATCCAGATGTTCAGAAATTTGCCGATCTTGCCGCAGTCCAAAAATCAACCATTGAAGAACTTA
AGGATTCATACGAAAAGCCGCAGGTCGTTGCCACTACTTGTCTCGGAATCAACCATAACATTTTCAACCAACGCA
TTTTTGACTATTGTATTGTCGACGAAGCATCGCAGATCACGCTCCCAGTCTGCCTCGGCCCGATTCGTATGGCAA
GGACTTTCATCCTGGTGGGTGATCACTATCAATTGCCGCCGCTTGTGCAGAATAAAGCGGCCCAGGAAGGAGGAC
TTGATATCAGTCTCTTCAAACTACTATCGGATGCACAACCAGGTTCGGTTGTCAACCTAGAGCATCAGTACCGCA
TGTGTGAGGAAATCATGTTACTTTCAAACACTCTGATTTACTCGGGCCGTCTCAAATGCGGCACGCCGCAGGTAG
CAGCCCGATCTTTGGATATACCCGACATCAACGCACTAGAGAAATTCCATGTCGAGGACTTGAGTCATGCTCTGT
CACAGTCAACCCGAGAAATATGCCCGGGTGTCCCCAGTAGCCCGTGTTGGCTCCGAGACTTACTGACGCCATCTG
CGAAGACCCGCCTGGTCAACACCGATCCCATCGGCCCCGCAGCCCTCGAGATAGCACAGGGAAACCGTGTCGTGA
ATCACATGGAGGTCTTCCTTTGCTCGCAACTTGTGGAGTCATTCATTGCCTGTGGTATTCCCGCGCGCGACATTG
GTGTGATCACTTTCTACCGCAGTCAACTCTCGCTCATTCGCCAGAGCCTGCGACGCTACGGCCCAGATCTGGAAA
TGCACACCACAGACAAGTTCCAAGGCCGCGACAAAGCGGTCATCATTTTGAGCTGCGTCCGCAGTAACGCCGAAA
ACAACGTCGGCGAGCTACTGCGCGACTGGCGCCGTGTCAACGTCGCCTTCACCCGCGCCCAGACCAAGCTCCTCG
TTGTCGGCAGCAGATCCACTCTCCGTGATGGCAACGAGCTCCTCTGCAAATATGTGCGCCTGATGGAAAGCAAAA
ATTGGGTTTATAACTTGCCCAGCGGAGCGATAGAGAAGCATTTCTTCCCCTCTTGTACCACACAATCGCAGCTCA
TGTCTCCGGGTGCGGCTTTGACTCCTCGCTCTACCAAGGGCAAAGGTAATGGCAAGAACAAATTGCCTCCTTCGC
GTTCTTCCCGTGAACCACTGAGCCCATTGGGCTCCCGACAAGCAGCGCCCGGTCTACGAAAGCCTTCCAAGACAG
GTGCAAAGTTGTTCAACGGCACGAAGGTGGTTGGGAATCGGCCCATCTTACGAGACATAGTGAATGACTTGACGG
GCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail